DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and bcl6

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001116278.1 Gene:bcl6 / 100126063 XenbaseID:XB-GENE-984479 Length:702 Species:Xenopus tropicalis


Alignment Length:526 Identity:98/526 - (18%)
Similarity:187/526 - (35%) Gaps:108/526 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            :::..|::.::.....||:.:...:|::.. :|...|||..||..||.|...:..|..:.....|
 Frog    11 IQFTRHANDVLLNLNRLRSRDILTDVIIVV-EGEHFRAHKTVLMACSGLFYAIFTDQMKCNSNII 74

  Fly    69 ML-PDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSASPPSVDVENHS 132
            .| .|:..:....:|.|:|....:|..:|:...:.....|.::..               |:...
 Frog    75 NLNTDVSAEGFRVLLDFMYTSRLNLRDSSIMAVMSTALYLQMEHV---------------VDTCQ 124

  Fly   133 LAVESAKSITGLQIAEAELLDDEEEPHPMV-----------SVP---ATTLAGSQHQPSHSSRSL 183
            ..::|::.|..::....|.|.......|.|           ::|   .|...|..:..|..|.|.
 Frog   125 RFLKSSEDIVAMKPPRDEFLPGRAMLPPDVMAYRNCEMSENTIPFRSGTMCDGRSYLSSLYSSST 189

  Fly   184 EYIDVY------------EPPKITYSIEHMDGSSSGNQFILT-ENTGTFTITQSASSLSKIEADE 235
            ....:|            :..|.....|....|.:..:.:|. ||:.|.     .....|:.:|.
 Frog   190 SSYPLYGHMPVPGFLFPEDEVKDMQMSEMQKASRNQKERVLPGENSRTL-----LGDYRKVMSDM 249

  Fly   236 TGTSGAEVDLGDDDVDADLAEDSEEHESQMIDEEFA----QADPLMELEAGTEMDDDDDVHDQLV 296
            :.......:....||..: ...||.|.:.:|....|    ::.|....|..|:.::.....|::.
 Frog   250 SFNMCHSNNYSQKDVAME-EPRSEAHYNMVIGSRSAGPSFRSSPFFTCEKTTKEEERTSSEDEIS 313

  Fly   297 DEEIDDKPRKLGGGKTRIRRPISAKAVKRLSDCKPTRIQQFAALKREVKDDINDALDLAADAVII 361
            ..   .||......:..:..|.|.:.    |||:|....:.::.|               :|.|.
 Frog   314 QH---FKPTNSPANRKGLVSPQSPQK----SDCQPNSPTESSSSK---------------NARIS 356

  Fly   362 EGLSLQKAADRFDISKTVLWRRVRTNPAYMRNNRERPSLQEAYERLKNGHSLKSISSELQIPMST 426
            :|.|...:.:..| .|...|::.....:..:.::|..:.|...:.| :.:|..|:||        
 Frog   357 QGSSSPVSKNSTD-PKACNWKKYMMLSSLKQRDKESCTKQSEIDNL-SPNSYTSLSS-------- 411

  Fly   427 LHRHKVRL-SAQGRLPNFVSCRKRDNTPKDEL---RDKLAKAVHACLNEGMSQN---------HA 478
             ::|.|:. :|..:     :..|.:.:.:|.|   ..||...|:..| ||..|:         ||
 Frog   412 -YQHPVKSENADDQ-----ASPKINGSTEDPLIPQASKLNNLVNRSL-EGSPQSSEGHSPLYVHA 469

  Fly   479 A--NLF 482
            :  |||
 Frog   470 SKFNLF 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 22/93 (24%)
BTB 35..118 CDD:197585 19/83 (23%)
HTH_psq 348..392 CDD:283007 7/43 (16%)
HTH_psq 458..501 CDD:283007 12/36 (33%)
bcl6NP_001116278.1 BTB 24..128 CDD:279045 23/119 (19%)
BTB 35..131 CDD:197585 22/111 (20%)
C2H2 Zn finger 515..536 CDD:275368
C2H2 Zn finger 543..563 CDD:275368
zf-H2C2_2 555..580 CDD:290200
C2H2 Zn finger 571..591 CDD:275368
zf-H2C2_2 583..608 CDD:290200
C2H2 Zn finger 599..619 CDD:275368
zf-H2C2_2 611..636 CDD:290200
C2H2 Zn finger 627..647 CDD:275368
zf-H2C2_2 640..664 CDD:290200
C2H2 Zn finger 655..673 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.