DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and Zbtb48

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_017175372.1 Gene:Zbtb48 / 100090 MGIID:2140248 Length:767 Species:Mus musculus


Alignment Length:212 Identity:58/212 - (27%)
Similarity:85/212 - (40%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATIMLPDI 73
            ||..::......|...|:|:..| ...|:..:||..||:.||...:.:..|   |...:::||..
Mouse    38 HSVRVLQELNKQREKGQYCDATL-DVGGLVFKAHWSVLACCSHFFQRIYGD---GTGGSVVLPAG 98

  Fly    74 RGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAI----SFECNPS--------ASPPSV 126
            ..::...:|.|.|.|..:|.|.:..:.|.|...|.:..|:    ||:...|        ..|.|.
Mouse    99 FAEIFGLLLDFFYTGHLALTSGNRDQVLLAAKELRVPEAVELCQSFQPQTSVGQAQSGLGQPASQ 163

  Fly   127 DVENHSLAVESAKSITGLQIAEA----ELLDDEEEP----HPMVSVPA--TT--LAGSQHQ---P 176
            ||::|      .|..|.|...|.    .|...::||    .|.:..||  ||  |.|...|   |
Mouse   164 DVKSH------LKEPTDLDEEEVFRTLSLASVDQEPRDTEQPQLGTPAQSTTAFLCGKLTQALKP 222

  Fly   177 SHSSRSLEYIDVYEPPK 193
            | .|...|..|..|||:
Mouse   223 S-PSEDKESEDCKEPPR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 24/92 (26%)
BTB 35..118 CDD:197585 23/86 (27%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
Zbtb48XP_017175372.1 BTB_POZ_ZBTB48_TZAP_KR3 38..145 CDD:349541 28/110 (25%)
C2H2 Zn finger 316..336 CDD:275368
zf-H2C2_2 328..351 CDD:372612
C2H2 Zn finger 344..395 CDD:275368
zf-H2C2_2 387..410 CDD:372612
C2H2 Zn finger 403..424 CDD:275368
PHA03247 <426..583 CDD:223021
zf-H2C2_2 586..610 CDD:372612
C2H2 Zn finger 602..623 CDD:275368
C2H2 Zn finger 631..651 CDD:275368
zf-H2C2_2 644..668 CDD:372612
zf-C2H2 657..679 CDD:333835
C2H2 Zn finger 659..679 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.