DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and zbtb6

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_031762671.1 Gene:zbtb6 / 100037884 XenbaseID:XB-GENE-5823898 Length:448 Species:Xenopus tropicalis


Alignment Length:273 Identity:60/273 - (21%)
Similarity:96/273 - (35%) Gaps:73/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRN-LLVDVPRGQEA 66
            |.::......::.....||..|..|:|.:...| .....|..|.:.||..||: .|::..|....
 Frog    41 HFRFEQQGDGVLHKMNILREQNLFCDVSIYIND-AEFHGHKVVFAACSTFMRDQFLLNQSRQVHI 104

  Fly    67 TIMLPDIRGD--LLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFEC----------NP 119
            ||:.....|.  ||.|     |.|...:....|.::|.|.:.|.:...:. :|          .|
 Frog   105 TILQNAEVGQKLLLSC-----YTGVLEVKKKELLKYLTAASYLQMVHIVE-KCTDALSQYLKNEP 163

  Fly   120 SASPPSVDVENHSLA-VESAKSITG----LQIAEAELL--------DDEEEPHPMVSVPATTLAG 171
            ...|.|.|..  .|| :|:|.|:..    ::::|...|        :|.|:             |
 Frog   164 ETQPLSKDPS--GLAEIETADSLDKDCEIIELSEDSPLNLDFQVKKEDNEQ-------------G 213

  Fly   172 SQHQP-----SHSSRSLEYID----VYEPPKITYSIEHMD--------GSSSGNQFILTENTGTF 219
            ..|.|     ..||..::|.|    ::....:..|..:.|        .||..|.|        |
 Frog   214 RIHSPISEKNDISSVEIDYKDNDICIFRMDSLPESASNADTEQFPQPCTSSKSNMF--------F 270

  Fly   220 TITQSASSLSKIE 232
            :.||.:|..|.:|
 Frog   271 SETQHSSINSTVE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 26/95 (27%)
BTB 35..118 CDD:197585 22/95 (23%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
zbtb6XP_031762671.1 BTB_POZ_ZBTB6 40..155 CDD:349506 28/120 (23%)
C2H2 Zn finger 325..345 CDD:275368
zf-C2H2 348..370 CDD:395048
C2H2 Zn finger 350..370 CDD:275368
zf-C2H2_8 353..423 CDD:406359
zf-H2C2_2 362..386 CDD:404364
C2H2 Zn finger 378..398 CDD:275368
C2H2 Zn finger 406..423 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.