DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-30 and NDUFS3

DIOPT Version :9

Sequence 1:NP_647775.1 Gene:ND-30 / 38378 FlyBaseID:FBgn0266582 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_004542.1 Gene:NDUFS3 / 4722 HGNCID:7710 Length:264 Species:Homo sapiens


Alignment Length:265 Identity:171/265 - (64%)
Similarity:201/265 - (75%) Gaps:15/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ARAAVAALSAKHVVPAAGSTALRMASTTPV--------EPKKAD-KPTVRQPDAVARSHLSDFGR 65
            |.||||.|..:.::   |::||...:..|.        |...|| :||||..:.||...||.||.
Human     2 AAAAVARLWWRGIL---GASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGE 63

  Fly    66 YVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGVDVPCRKNRFEV 130
            ||||.||||||:||::..:||||.|.|:||:|||.||:||..|||.:|||:..||||.|:||||:
Human    64 YVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEI 128

  Fly   131 VYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGF 195
            ||||||||:|||||||||||||||::||..|.|||||||||||||:|||||||||||||||||||
Human   129 VYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGF 193

  Fly   196 EGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNANPPAEVVPPQ 260
            ||||.|:|||||||||||||||.||||.||:|||||||||||::|||.||.:|.   |.|.:..:
Human   194 EGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQ---PPESLKLE 255

  Fly   261 APAKK 265
            |..||
Human   256 AGDKK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-30NP_647775.1 PRK06074 60..242 CDD:235691 142/181 (78%)
NDUFS3NP_004542.1 PRK06074 58..240 CDD:235691 142/181 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160136
Domainoid 1 1.000 210 1.000 Domainoid score I2837
eggNOG 1 0.900 - - E1_COG0852
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3346
Inparanoid 1 1.050 325 1.000 Inparanoid score I2499
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51846
OrthoDB 1 1.010 - - D1276923at2759
OrthoFinder 1 1.000 - - FOG0005716
OrthoInspector 1 1.000 - - oto91029
orthoMCL 1 0.900 - - OOG6_101398
Panther 1 1.100 - - LDO PTHR10884
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3435
SonicParanoid 1 1.000 - - X4118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.