DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-30 and ndufs3

DIOPT Version :9

Sequence 1:NP_647775.1 Gene:ND-30 / 38378 FlyBaseID:FBgn0266582 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001003921.1 Gene:ndufs3 / 394690 XenbaseID:XB-GENE-997488 Length:250 Species:Xenopus tropicalis


Alignment Length:262 Identity:157/262 - (59%)
Similarity:190/262 - (72%) Gaps:20/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAALIRNLGARAAVAALSAKHVVPAAGSTALRMASTTPVEPKKADKPTVRQPDAVARSHLSDFGR 65
            |.|.:|  .||..:....|...:|     .:|:..||     ...:||||..|.|..:.||.||.
 Frog     1 MLAGVR--AARGLIRGACAFRSLP-----QVRLEGTT-----TETRPTVRPQDKVQLNQLSAFGE 53

  Fly    66 YVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGVDVPCRKNRFEV 130
            ||||.||||||:||:|...||||::.|:||:|||.||:||..|||.:|.|:..||||.:.||||:
 Frog    54 YVAEILPKYVQQVQVTCNGELEVMVHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPAKTNRFEI 118

  Fly   131 VYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGF 195
            ||||||||:|:|:||.||||||||::||..|.:||||||||:|||||||||||||||||||||||
 Frog   119 VYNLLSLRFNTRMRVMTYTDELTPVESAVPVFEAANWYEREVWDMYGVFFANHPDLRRILTDYGF 183

  Fly   196 EGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNANPPAEVVPPQ 260
            ||||.|:|||||||||:|||||.||||.||::|:|||||||||:|||.||..|.        .|:
 Frog   184 EGHPFRKDFPLSGYVEVRYDDEVKRVVAEPVQLSQEFRKFDLSSPWEAFPAHRQ--------QPE 240

  Fly   261 AP 262
            :|
 Frog   241 SP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-30NP_647775.1 PRK06074 60..242 CDD:235691 134/181 (74%)
ndufs3NP_001003921.1 PRK06074 48..230 CDD:235691 134/181 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 201 1.000 Domainoid score I2964
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3346
Inparanoid 1 1.050 313 1.000 Inparanoid score I2536
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276923at2759
OrthoFinder 1 1.000 - - FOG0005716
OrthoInspector 1 1.000 - - oto104811
Panther 1 1.100 - - LDO PTHR10884
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.