DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BtbVII and Nacc2

DIOPT Version :9

Sequence 1:NP_647774.2 Gene:BtbVII / 38376 FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001032175.1 Gene:Nacc2 / 67991 MGIID:1915241 Length:586 Species:Mus musculus


Alignment Length:139 Identity:36/139 - (25%)
Similarity:62/139 - (44%) Gaps:21/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PNFISVCSSLLHN----GTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTN-------PCQHP 68
            |||.:.....|:.    |...||::..:|:..:||:.||:|.|.||:.||:.|       |...|
Mouse    10 PNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGTVP 74

  Fly    69 IVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTDPANLTKSDSKSST 133
            ....:.:        :.|.|.|::.::..:...::.||..|:|:.:.|..||  .:.|..|....
Mouse    75 PACFQQI--------LSFCYTGKLTMAASEQLVVMYTAGFLQIQHIVERGTD--LMFKVSSPHCD 129

  Fly   134 DGTEMVGGA 142
            ..|.|:..|
Mouse   130 SQTAMIEDA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 25/103 (24%)
BTB 32..117 CDD:197585 23/91 (25%)
Nacc2NP_001032175.1 BTB_POZ_BTBD14A_NAC2 1..131 CDD:349598 33/130 (25%)
Prog_receptor <139..241 CDD:366948 36/139 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..196
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..272
BEN 371..448 CDD:214981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.