DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BtbVII and LOC3290595

DIOPT Version :10

Sequence 1:NP_647774.2 Gene:BtbVII / 38376 FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:XP_061504414.1 Gene:LOC3290595 / 3290595 VectorBaseID:AGAMI1_013978 Length:232 Species:Anopheles gambiae


Alignment Length:125 Identity:25/125 - (20%)
Similarity:45/125 - (36%) Gaps:42/125 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AVRSPSYLLSFLLLSNRFGIGNCIMLV--WRHGSTLRPCKCPLCRRPISLLVPSEETVRSRNDAT 91
            |:.|..|.::..||         |:|:  ||                        ..|.....|.
Mosquito    28 AITSAIYTINISLL---------IVLIYSWR------------------------INVNMHKSAD 59

  Fly    92 VSEVLHDVE-TYNRVFGGQSSGLIQRMQDLPFLLRRLLREMMDPQRTLPLVIRARVYIAL 150
            :.:|.:.|: .|..:.|.|.|.::..:    .|:..:.||  :|...:|.:|....::||
Mosquito    60 LQDVYYGVQIAYFAIIGTQMSMILLSI----VLIFGICRE--NPGLIVPWIIGYITFMAL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB_POZ_BAB-like 30..113 CDD:349624 16/85 (19%)
LOC3290595XP_061504414.1 None

Return to query results.
Submit another query.