DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BtbVII and ZBTB12

DIOPT Version :9

Sequence 1:NP_647774.2 Gene:BtbVII / 38376 FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_862825.1 Gene:ZBTB12 / 221527 HGNCID:19066 Length:459 Species:Homo sapiens


Alignment Length:221 Identity:47/221 - (21%)
Similarity:72/221 - (32%) Gaps:86/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DVTLAAEGRQLQAHKIVLSACSSYFQALFTTNP-------CQHPIVILKDVQYDDLKTMVDFMYY 89
            |||:.|:..:.:.||::|:|||.:.:..|..||       ..|...|:.|:........::|...
Human    34 DVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVR 98

  Fly    90 GEVN----VSQEQLPHILK-----TAEMLKIK-GLAEMPTDPANLTKSDSKSST----------- 133
            ..||    .|..|:.|:::     .::.::.| ||.|.....|:|..|.|.:.:           
Human    99 DIVNYLTAASYLQMEHVVEKCRNALSQFIEPKIGLKEDGVSEASLVSSISATKSLLPPARTPKPA 163

  Fly   134 ------------------------------------DGTEMV---------------------GG 141
                                                |..|.|                     ||
Human   164 PKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVAHRLKPPGG 228

  Fly   142 AGVGTGAGNSAGS-LGAGSGSSVGDS 166
            .|.|.|.|.|.|. ||..:.|||..|
Human   229 LGGGLGIGGSVGGHLGELAQSSVPPS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 25/101 (25%)
BTB 32..117 CDD:197585 25/101 (25%)
ZBTB12NP_862825.1 BTB 23..127 CDD:306997 22/92 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..179 0/25 (0%)
C2H2 Zn finger 335..355 CDD:275368
zf-C2H2 359..381 CDD:306579
COG5048 <361..>448 CDD:227381
C2H2 Zn finger 361..381 CDD:275368
C2H2 Zn finger 389..409 CDD:275368
C2H2 Zn finger 417..435 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.