DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg2 and GSY2

DIOPT Version :9

Sequence 1:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_013359.1 Gene:GSY2 / 850962 SGDID:S000004248 Length:705 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:60/275 - (21%)
Similarity:89/275 - (32%) Gaps:108/275 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 DTFRRLSTV------------PDVLYPS----LHTQYFDQMQKKLEQRSALLDEPVHPRV----- 218
            |.|..:|.:            ||.:.|:    :..|.|.:.|    ...||..|.::..|     
Yeast   242 DVFTTVSQITAFEAEHLLKRKPDGILPNGLNVIKFQAFHEFQ----NLHALKKEKINDFVRGHFH 302

  Fly   219 -----PLNAFIYLDI-NRYERKKN------HALAL--HSLRLLGD--------MLPATDFKRCRL 261
                 .|:..:|..| .|||.|..      .|||.  :.|::.|.        ::||.:......
Yeast   303 GCFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAKNNSFTVE 367

  Fly   262 IIAGGYDTRCMENV-------------EHFAELEH----------LTEELKLQDHVVLLRSPTDE 303
            .:.|..:.|.:||.             :|.....|          |.|.||..|.|:|.|     
Yeast   368 ALKGQAEVRALENTVHEVTTSIGKRIFDHAIRYPHNGLTTELPTDLGELLKSSDKVMLKR----- 427

  Fly   304 EKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGG 368
               |:|     .|..||    |.:|        |:|       |..:|..:...:..|..:    
Yeast   428 ---RIL-----ALRRPE----GQLP--------PIV-------THNMVDDANDLILNKIRQ---- 461

  Fly   369 AMLQLFRDEQLRVKM 383
              :|||.....||||
Yeast   462 --VQLFNSPSDRVKM 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 60/275 (22%)
GT1_ALG2_like 2..404 CDD:99977 60/275 (22%)
GSY2NP_013359.1 GT3_GSY2-like 7..616 CDD:340824 60/275 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.