DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg2 and ALG1L2

DIOPT Version :9

Sequence 1:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001129624.1 Gene:ALG1L2 / 644974 HGNCID:37258 Length:215 Species:Homo sapiens


Alignment Length:205 Identity:45/205 - (21%)
Similarity:64/205 - (31%) Gaps:71/205 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 EPVHPRVPLNAFIYLDINRYERKKNHALA--LHSLRLLGDMLPATDFKRCRLIIAGGYDTRCMEN 274
            ||..|....:||.       ||.....|.  ||              :|..|:::.         
Human    46 EPEDPDTERSAFT-------ERDSGSGLVTRLH--------------ERPALLVSS--------- 80

  Fly   275 VEHFAELEHLT---EELKLQDHVVLLRSPTDEEKCRLLFAAH------CLLYTPENEHFGIVPLE 330
             ..:.|.|.||   :.|.....|:..:.|..|...||:...|      |:   |..|..|:.||.
Human    81 -TSWTEFEQLTLDGQNLPSLVCVITGKGPLREYYSRLIHQKHFQHIQVCI---PWLEGRGLPPLL 141

  Fly   331 G-----------------------MY-CSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGGAML 371
            |                       |: |..|..|:|.....|.|.......:.|.:|:.  .|.|
Human   142 GSVDLDVCLDTSSSGLDLPMKVVDMFRCCLPACAVNFKCLHELVKHEENRLVFEDSEEL--AAQL 204

  Fly   372 QLFRDEQLRV 381
            |.|.|..|::
Human   205 QYFADAFLKL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 45/205 (22%)
GT1_ALG2_like 2..404 CDD:99977 45/205 (22%)
ALG1L2NP_001129624.1 Glycosyltransferase_GTB_type <8..206 CDD:299143 41/195 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..66 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.