DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg2 and ALG1

DIOPT Version :9

Sequence 1:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_061982.3 Gene:ALG1 / 56052 HGNCID:18294 Length:464 Species:Homo sapiens


Alignment Length:294 Identity:67/294 - (22%)
Similarity:108/294 - (36%) Gaps:78/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PHRPKVL---FYCHFPDQLL--------SSREGLLKR-------LYRLPINWLEEHTIGLADKVL 163
            |:.|.||   :|..|..:|.        :.||.|...       :|..|.::.:|..:.|..::.
Human   170 PNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIRAVTVYDKPASFFKETPLDLQHRLF 234

  Fly   164 VNSKFTLRVFQDTFRRLSTVPDVLYPSLHTQYFDQ------MQKKLEQRSALL--------DEPV 214
            :.    |......||..|...|   |......|.:      :..:|.:|.|||        ||..
Human   235 MK----LGSMHSPFRARSEPED---PVTERSAFTERDAGSGLVTRLRERPALLVSSTSWTEDEDF 292

  Fly   215 HPRVPLNAFIYLDINRYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAG-----GYDTRCMEN 274
                   :.:...:.::|:          |.|.|..||:.   .|  :|.|     .|.:|.:..
Human   293 -------SILLAALEKFEQ----------LTLDGHNLPSL---VC--VITGKGPLREYYSRLIHQ 335

  Fly   275 VEHFAELEHLTEELKLQDHVVLLRSPTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVV 339
             :||..::..|..|:.:|:.:||.| .|...|  |..:...|..|    ..:|.:.|  |..||.
Human   336 -KHFQHIQVCTPWLEAEDYPLLLGS-ADLGVC--LHTSSSGLDLP----MKVVDMFG--CCLPVC 390

  Fly   340 ALNSGGPTETVVSTSTGFLCEKTEKSFGGAMLQL 373
            |:|.....|.|.....|.:.|.:|:.  .|.||:
Human   391 AVNFKCLHELVKHEENGLVFEDSEEL--AAQLQM 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 67/294 (23%)
GT1_ALG2_like 2..404 CDD:99977 67/294 (23%)
ALG1NP_061982.3 PLN02275 27..424 CDD:215155 67/294 (23%)
GT1_ALG1_like 30..461 CDD:99986 67/294 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..262 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.