DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg2 and Alg1

DIOPT Version :9

Sequence 1:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster


Alignment Length:267 Identity:56/267 - (20%)
Similarity:100/267 - (37%) Gaps:80/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GTFPVHVVGDWLPRGLFGRFYAIC------AYLRMLYAAIYASFFMPQREQVDVVVCDLIS--VC 109
            |..||.|:.|..|    .:|:.|.      .||::  |..|..|.....||.||:....::  :.
  Fly   185 GIGPVKVLYDRAP----AQFHPIDLTHKHELYLKL--AKDYPQFQAKDAEQSDVLEATALTQKLA 243

  Fly   110 IPVLRFAPHRPKVLFYCHFPDQLLSSREGLLKRLYRLPINWLEEHTIGLADKVLVNSKFTLRVFQ 174
            ..|:::.|.|..|         |:||            .:|..:...|:..|       .|:.::
  Fly   244 SGVVQYRPQRQAV---------LVSS------------TSWTPDEDFGILLK-------ALQAYE 280

  Fly   175 DTFRRLSTVPDVLYPSL----------HTQYFDQMQKKLEQRSAL----LDEPVHPRVPLNAFIY 225
            :|    :....::||||          ...|..:::|...|:.::    |:...:|.|..:|  .
  Fly   281 ET----AQAEPLVYPSLLCIITGKGPQKEHYVAEIEKLQWQKVSVITPWLEIEDYPTVLASA--D 339

  Fly   226 LDINRYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAGGYDTRCM-ENVEH------FAELEH 283
            |.:..:.......|.:..:.:.|..||.     |      .||.:|: |.|:|      |.:...
  Fly   340 LGVCLHWSTSGLDLPMKVVDMFGSGLPV-----C------AYDFKCLDELVKHGENGFVFGDHVQ 393

  Fly   284 LTEELKL 290
            |.|:|::
  Fly   394 LAEQLRI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 56/267 (21%)
GT1_ALG2_like 2..404 CDD:99977 56/267 (21%)
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 56/267 (21%)
PLN02275 7..402 CDD:215155 56/267 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.