DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg2 and gsy-1

DIOPT Version :9

Sequence 1:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_496736.1 Gene:gsy-1 / 174924 WormBaseID:WBGene00001793 Length:672 Species:Caenorhabditis elegans


Alignment Length:217 Identity:42/217 - (19%)
Similarity:72/217 - (33%) Gaps:55/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DQMQKKLEQR------SALLDEPVHPRVPLNAFIYLDINRYERKKNHALALHSLRLLGDMLPATD 255
            |::::|:.||      ...|.||.....|.:..:.         |...::||:    ..:.|...
 Worm   416 DRIKEKVGQRIFDICLQGHLPEPEELMSPADNILL---------KRCIMSLHN----SSLPPICT 467

  Fly   256 FKRCRLIIAGGYDTRCMENVEHFAELEHLTEELKLQDHVVLLRSPT-----DEEKCRLLFAAHCL 315
            ....|.      |...:|::...:......:.:|:..|...|.|.:     |.|.  .:...|..
 Worm   468 HNMIRA------DDPVLESLRRTSLFNKPEDRVKVVFHPEFLSSVSPLIGLDYED--FVRGCHLG 524

  Fly   316 LYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGGAMLQLFRD-EQL 379
            ::....|.:|..|.|......|.|:.|..|                    ||..|.:...| ||.
 Worm   525 VFPSYYEPWGYTPAECTVMGIPSVSTNLSG--------------------FGCFMQEHVEDHEQK 569

  Fly   380 RVKMGDQGHKRVQQKFSFQAFA 401
            .:.:.|:.||..::  |.|..|
 Worm   570 GIYVIDRRHKAAEE--SVQELA 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 42/217 (19%)
GT1_ALG2_like 2..404 CDD:99977 42/217 (19%)
gsy-1NP_496736.1 GT1_Glycogen_synthase_GSY2_like 43..636 CDD:99967 42/217 (19%)
Glycogen_syn 48..672 CDD:283373 42/217 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.