DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg2 and Gys1

DIOPT Version :9

Sequence 1:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_109603.2 Gene:Gys1 / 14936 MGIID:101805 Length:738 Species:Mus musculus


Alignment Length:196 Identity:37/196 - (18%)
Similarity:62/196 - (31%) Gaps:48/196 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 RYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAG----GYDTRCMEN------------VEHF 278
            ::.||...:|.:.||..:..||...||...:..|..    .:...|..|            :...
Mouse   399 KFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRI 463

  Fly   279 AELEHLTEELKLQDHVVLLRS-----PTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPV 338
            .......:.:|:..|...|.|     |.|.|:  .:...|..::....|.:|..|.|......|.
Mouse   464 GLFNSSADRVKVIFHPEFLSSTSPLLPVDYEE--FVRGCHLGVFPSYYEPWGYTPAECTVMGIPS 526

  Fly   339 VALNSGG-----------PT--------------ETVVSTSTGFLCEKTEKSFGGAMLQLFRDEQ 378
            ::.|..|           |:              :...|..|.||....::|....::|..|.|:
Mouse   527 ISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTER 591

  Fly   379 L 379
            |
Mouse   592 L 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 37/196 (19%)
GT1_ALG2_like 2..404 CDD:99977 37/196 (19%)
Gys1NP_109603.2 Glycogen_syn 31..663 CDD:368562 37/196 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..738
RGCC 645..>732 CDD:373604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.