DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and yajR

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_414961.4 Gene:yajR / 945058 ECOCYCID:G6241 Length:454 Species:Escherichia coli


Alignment Length:382 Identity:76/382 - (19%)
Similarity:139/382 - (36%) Gaps:84/382 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 WGL------------LTMPIISTLNQTFPDHTFLMNGLVMGIKGILSFLSAPLIGALSDIWGRKF 319
            |||            :.:|:::|........:..:.|:.:||.|:...:.....|.|||..|||.
E. coli    15 WGLGTVFSLRMLGMFMVLPVLTTYGMALQGASEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKP 79

  Fly   320 FLL--VTVFFTCLPIPLMSINTWWFFAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASAT 382
            .::  :.||.....|..:|.:.|......::.|:.|:. :.|.|.::|:|..:.|:||......:
E. coli    80 LIVGGLAVFAAGSVIAALSDSIWGIILGRALQGSGAIA-AAVMALLSDLTREQNRTKAMAFIGVS 143

  Fly   383 FAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESLSEKMRPASWGAPISWEQ- 446
            |..:..|:..||..:....|...:..:...:|...:...:..||.|.:..:...|.....|:.: 
E. coli   144 FGITFAIAMVLGPIITHKLGLHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKV 208

  Fly   447 -ADPFLALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVGILS- 509
             |:|.|.....|      ::||.:||                          :|.|:|:.|.|: 
E. coli   209 LAEPRLLKLNFG------IMCLHILL--------------------------MSTFVALPGQLAD 241

  Fly   510 -------------ITVQVTLGSFM-------------QVFGAKRTIIMGLALEIVQLLWYGFGSQ 548
                         .|:.:..||.:             |||    ...:||.:....:||    :.
E. coli   242 AGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQVF----VFCVGLIVVAEIVLW----NA 298

  Fly   549 KWMMWSAGVVAALGSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFG 605
            :...|...|...|..:.:..:.|.:....:.||....:|...|:......||.|:.|
E. coli   299 QTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGTAMGVYSTSQFLGVAIGG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 76/382 (20%)
MFS_1 257..601 CDD:284993 73/376 (19%)
yajRNP_414961.4 MFS_YajR_like 17..389 CDD:341025 74/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.