DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and AZR1

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_011740.3 Gene:AZR1 / 853139 SGDID:S000003456 Length:613 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:57/293 - (19%)
Similarity:107/293 - (36%) Gaps:73/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 MYGDTLVVALSTAIALLDVFFILVAVPE------------------SLSEKMRPASWG---APIS 443
            :|...:.:|||..:|.||:..:...:.|                  ||...:....||   .||.
Yeast    66 LYASLIALALSLFLAALDIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIG 130

  Fly   444 WEQADPF-LALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVS---VFIAI 504
            :::...| :.:.::|:..:.|...:::|:.....||...|....|...:|...||.|   :.||:
Yeast   131 FKETMLFAIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAV 195

  Fly   505 VGILSITVQVTLGSFM-QVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAGVVAALGSITYPA 568
            :. .|..:...:|.|: .||.:..|             |      :|..:   |...:|.:.:  
Yeast   196 LS-CSFAIASVVGPFLGGVFTSSVT-------------W------RWCFY---VNLPIGGLAF-- 235

  Fly   569 ISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVFYLFNVDLNDDHDSHAKSSGSRATNV 633
               |:.|:.........|..:..:|...:.....|..|.::|..:      ...:|.:|.|...:
Yeast   236 ---FLFLFFYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKI------KGFSKLNGWRKPFM 291

  Fly   634 EKISQHVPGPPFVFGAL-CVFCA----IIVSAF 661
            |.|        |::..: .|||:    .|:.||
Yeast   292 ELI--------FMYDIIEFVFCSAGFTCILLAF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 45/237 (19%)
MFS_1 257..601 CDD:284993 42/226 (19%)
AZR1NP_011740.3 MFS_Azr1_MDR_like 83..540 CDD:341045 51/276 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.