DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and SLC18A2

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_003045.2 Gene:SLC18A2 / 6571 HGNCID:10935 Length:514 Species:Homo sapiens


Alignment Length:408 Identity:94/408 - (23%)
Similarity:152/408 - (37%) Gaps:114/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TLNQTFPDHTF----------------LMN-----GLVMGIKGILSFLSAPLIGALSDIWGRKFF 320
            ||:||...|..                |:|     ||:...|..:..::.|.||.|::..|    
Human    97 TLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIG---- 157

  Fly   321 LLVTVFFTCLPIP------LMSINTWWF-------FAMI--SISGAFAVTFSVV-FAYVADV-TT 368
                     .|||      :|.::|..|       |.:|  |:.|..:...||. ...:|.| |.
Human   158 ---------YPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTD 213

  Fly   369 PEERSKAYGLASATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESLSEKM 433
            .|||....|:|....|..:::.|..|:.|.|..|.|....:..|:.|||....|..:..|   ::
Human   214 DEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPS---RV 275

  Fly   434 RPASW-GAPISWEQADPFLALRKVGT----DKTVLML--CLTVLL-------------SYLPEAG 478
            :|.|. |.|::....||:: |...|:    :..:.||  .|.:.:             ::||.:.
Human   276 QPESQKGTPLTTLLKDPYI-LIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASI 339

  Fly   479 EY---SCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQ-VFGAKRTII-----MGLA 534
            .|   :.:|..|..|||      ....|::|::.:.|.:....|.: ::|    :|     :|.|
Human   340 SYLIGTNIFGILAHKMG------RWLCALLGMIIVGVSILCIPFAKNIYG----LIAPNFGVGFA 394

  Fly   535 LEIVQLLWYGFGSQKWMMWSAGV------VAALGSITYPAISAFVSLYAAPESQGAVQGMITGMR 593
            :.:|         ...||...|.      |:..||:...|..||...||...|.|.......|..
Human   395 IGMV---------DSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFP 450

  Fly   594 GLCNGLGPAVFGVVFYLF 611
            .|.     .:.|::..||
Human   451 WLM-----TIIGIIDILF 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 94/408 (23%)
MFS_1 257..601 CDD:284993 91/396 (23%)
SLC18A2NP_003045.2 MFS_1 130..437 CDD:311564 80/342 (23%)
2_A_01_02 132..273 CDD:273318 40/153 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.