DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and SLC18A1

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001129163.1 Gene:SLC18A1 / 6570 HGNCID:10934 Length:525 Species:Homo sapiens


Alignment Length:375 Identity:72/375 - (19%)
Similarity:138/375 - (36%) Gaps:104/375 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 GLVMGIKGILSFLSAPLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVT 355
            |::...|.::..|..|.:|.|::..|  :.:.:...|.     :|.::|    .|.:.||.:.:.
Human   140 GVLFASKAVMQLLVNPFVGPLTNRIG--YHIPMFAGFV-----IMFLST----VMFAFSGTYTLL 193

  Fly   356 F--------SVVFAYVADV-------TTPEERSKAYGLASATFAASLVISPALGNALMEMYGDTL 405
            |        ...|:.||.:       |...||.:|.|.|....|..|::....|:.:.|..|.:.
Human   194 FVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSA 258

  Fly   406 VVALSTAIALLD-VFFILVAVPESLSEKMRPASWGAPISWEQADPF-------LALRKVGT---D 459
            ...:...:|||| ...:.:..|..:|.:   ::.|.|:.....||:       :....:|.   :
Human   259 PFLILAFLALLDGALQLCILQPSKVSPE---SAKGTPLFMLLKDPYILVAAGSICFANMGVAILE 320

  Fly   460 KTVLMLCLTVL--------LSYLPEAGEY---SCMFVYLKLKMGFNYVEVSVFIAIVGI------ 507
            .|:.:..:..:        |::||.:..|   :.:|..|..||| .::...:.:.:||.      
Human   321 PTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKMG-RWLCSLIGMLVVGTSLLCVP 384

  Fly   508 --------------LSITVQVTLGSFMQVFG-----------------AKRTIIMGLAL------ 535
                          |.:.:.:...|.|.:.|                 |.....||.|:      
Human   385 LAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGG 449

  Fly   536 EIVQLLWYGFGSQKWMMWSAGVVAALGSITYPAISAFVSLYAAPESQGAV 585
            .||:.:  ||   .|:|...||:    :|.|..:..::....|.|.:.|:
Human   450 AIVKAI--GF---PWLMVITGVI----NIVYAPLCYYLRSPPAKEEKLAI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 72/375 (19%)
MFS_1 257..601 CDD:284993 72/375 (19%)
SLC18A1NP_001129163.1 MFS_1 139..445 CDD:284993 59/319 (18%)
2_A_01_02 140..281 CDD:273318 32/151 (21%)
MFS 302..>479 CDD:119392 31/186 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 503..525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.