DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and SLC46A2

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_149040.3 Gene:SLC46A2 / 57864 HGNCID:16055 Length:475 Species:Homo sapiens


Alignment Length:426 Identity:92/426 - (21%)
Similarity:161/426 - (37%) Gaps:104/426 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 FLMNGLVMGIKGILSFLSAPLIGALSDIWGRKFFL---LVTVFFTCLPIPLMSINTW------WF 342
            :::..||:|:..:   |||..:|.|||.:.||..:   |:....:.|.:.|..:..|      ..
Human    78 YIIYNLVVGLSPL---LSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGA 139

  Fly   343 FAMISISGAFAVTFSVVFAYVADVTTPEERSKA--------YGLASATFAASLVISPALGNALME 399
            .|:..:.|.|:..:|.|.| :..:.:.|.|...        .|||.  |..|:    |.|:...:
Human   140 AALNGLFGGFSAFWSGVMA-LGSLGSSEGRRSVRLILIDLMLGLAG--FCGSM----ASGHLFKQ 197

  Fly   400 MYGDT----LVVALSTAIALLDVFF--ILVAVPESLSEKMR--PA-------------------- 436
            |.|.:    ::.|.|.:.|...:.:  :::.||||:::..:  ||                    
Human   198 MAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLD 262

  Fly   437 ---SWGAPISWEQADPF---LALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNY 495
               :.|.|.|..:|.|.   :||..||.  .:..|.:...:..:|       :|| |:..:|:|.
Human   263 QQYAVGHPPSPGKAKPHKTTIALLFVGA--IIYDLAVVGTVDVIP-------LFV-LREPLGWNQ 317

  Fly   496 VEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAGVVAA 560
            |:|...:|....:.||..:.:..|.:.|.....|::|:.......|...|..:.:|.:.|..|..
Human   318 VQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGSGALLLAFVKETYMFYIARAVML 382

  Fly   561 LGSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVFYLFNVDLNDDHDSHAKS 625
            ...|....|            :.|:..:|.|          :.:|.||.:..:.|       |.:
Human   383 FALIPVTTI------------RSAMSKLIKG----------SSYGKVFVILQLSL-------ALT 418

  Fly   626 SGSRATNVEKISQ----HVPGPPFVFGALCVFCAII 657
            ....:|...||.|    ...|..|...:...|.|||
Human   419 GVVTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAII 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 80/375 (21%)
MFS_1 257..601 CDD:284993 77/364 (21%)
SLC46A2NP_149040.3 MFS_1 84..421 CDD:284993 81/385 (21%)
MFS <282..453 CDD:304372 42/209 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.