DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and Slc46a1

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_081016.2 Gene:Slc46a1 / 52466 MGIID:1098733 Length:459 Species:Mus musculus


Alignment Length:441 Identity:94/441 - (21%)
Similarity:157/441 - (35%) Gaps:122/441 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 QTFPDH-TFLMN--GLVMGIKGILSFLSAPLIGALSDIWGRKFFL-----------LVTVFFTCL 330
            :|...| |..||  |.::|:     |.|. |:||.||..||:..|           :|::|...|
Mouse    79 ETLTSHWTLYMNVGGFLVGL-----FWST-LLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQL 137

  Fly   331 PIPLMSINTWWFF----AMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLVISP 391
            .:.:      .||    |:.::.|.|....:..||.||||::...|:....|..|....:..::.
Mouse   138 ELHV------GFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLAS 196

  Fly   392 ALGNALMEMYGDT----LVVALSTAIALLDVFFILVAVPESLSEKMRPASWGAPISWEQADPFLA 452
            .||...:...|..    |.:||...:||...|.....|.|..|.::                 ..
Mouse   197 LLGGHWLRAQGYANPFWLALALLIVMALYAAFCFGETVKEPKSTRL-----------------FT 244

  Fly   453 LRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVGILSI------- 510
            ||.   .:::..|       |:..|.|.|.|  :|.|.....:|.|:|......||::       
Mouse   245 LRH---HRSIARL-------YVVPAPEKSRM--HLALYSLAIFVVVTVHFGAQDILTLYELSAPL 297

  Fly   511 ---TVQVTLGSFMQVFGAKRTII----------------MGLALEIVQLLWYGFGSQKWMMWSAG 556
               :..:..||..|......:::                :|||..|:.::.:.|.:...:|::..
Mouse   298 CWDSKLIGYGSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGY 362

  Fly   557 VVAALGSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVFYLFNVDLNDDHDS 621
            .:..|..:|.|.|.|.:|...:...|||:...:..:..|...:...:|..:   :...||     
Mouse   363 GLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSI---YPATLN----- 419

  Fly   622 HAKSSGSRATNVEKISQHVPGPPFVFGALCVFCAIIVSAFIPEGQTSTLEK 672
                             .:.|.||:.||..:        |||......|||
Mouse   420 -----------------FMKGFPFLLGAGLL--------FIPAILIGVLEK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 81/379 (21%)
MFS_1 257..601 CDD:284993 80/368 (22%)
Slc46a1NP_081016.2 MFS 73..443 CDD:119392 91/437 (21%)
MFS_1 94..407 CDD:284993 74/353 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.