DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and slc18a2

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001005688.1 Gene:slc18a2 / 448192 XenbaseID:XB-GENE-940058 Length:484 Species:Xenopus tropicalis


Alignment Length:369 Identity:81/369 - (21%)
Similarity:133/369 - (36%) Gaps:109/369 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 GLVMGIKGILSFLSAPLIGALSDIWGRK------FFL-----LVTVF-----FTCLPIPLMSINT 339
            ||::.||.||..|:.|::|.|.:..|..      ||:     |:..|     |.|:...|..|.:
 Frog   122 GLLLAIKAILQLLTNPIVGKLINRTGYDAPLFCGFFIVFLSSLMFAFANSYAFLCVARGLQGIGS 186

  Fly   340 WWFFAMISISGAFAVTFSVVFAYVADVTTPE--ERSKAYGLASATFAASLVISPALGNALMEMYG 402
              .|.|:|..|..|..|            |:  ||.||.|:|.:..|..::.....|:.:.|..|
 Frog   187 --SFTMVSAMGMLAHVF------------PDDAERGKAMGIAMSGVAIGILAGAPFGSVMYEFVG 237

  Fly   403 DTLVVALSTAIALLD-VFFILVAVPESLSEKMRPASWGAPISWEQADPFLALRKVGTDKTVLMLC 466
            ..........:|||| |..:.:..|...:....|.:   |......||::.:..||       ||
 Frog   238 KASPFLAIGVLALLDGVLQLFILRPTKFTPLAIPPT---PYRDLVLDPYIMVTAVG-------LC 292

  Fly   467 LTVL-------------------------LSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVG 506
            :..|                         ||:||....|              ::.::.|..:..
 Frog   293 IANLTFGMLEPTIPIRMMETMCAPRYQLGLSFLPSVITY--------------FICLNAFSGLAQ 343

  Fly   507 ILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQL------LWYGFGSQKWMMWSAGVVAALGSIT 565
            .:...:.:.:|..:|..|   .:.:.|||.|..|      |.:|||..:..:..  ::|.|..:.
 Frog   344 KIGRWLCIMIGMIIQGIG---VMFLPLALNIFGLIGPDAALGFGFGLMETSVMP--LMAHLVDLR 403

  Fly   566 YPAISAFVSLYAAPESQGAVQGMITGMRGLCNG--LGPAVFGVV 607
            :  .|.:..:||..:.            .||.|  |||:..|.:
 Frog   404 H--TSNYGGIYAISDI------------ALCIGYALGPSCGGAI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 81/369 (22%)
MFS_1 257..601 CDD:284993 78/361 (22%)
slc18a2NP_001005688.1 MFS_1 121..427 CDD:311564 78/361 (22%)
2_A_01_02 122..263 CDD:273318 41/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.