DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and mrva

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001261505.1 Gene:mrva / 38808 FlyBaseID:FBgn0035763 Length:478 Species:Drosophila melanogaster


Alignment Length:189 Identity:46/189 - (24%)
Similarity:72/189 - (38%) Gaps:69/189 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 AWGLLTMPIISTLNQTF--------PDHTFLMNGLVMGIKGILSFLSAPLIGALSDIWGRKFFLL 322
            |:.:...|.|: |.|.|        |.....::.||.    :::.:|:|:.|.:.|..||..   
  Fly   282 AYYVAIFPFIA-LGQNFFVDRFGLSPAEANTVDSLVY----LIAAVSSPVFGFIIDKLGRNV--- 338

  Fly   323 VTVFFTCLPIPLMSINTWWFFAMISISGAFA-VTFSVVFAYVADVTTPEERSKAYGLASATFAAS 386
                            ||.|.|.::..||.| :||:.:..||..:        ..||:.:..|||
  Fly   339 ----------------TWVFTATLTTIGAHALLTFTQLTPYVGMI--------IMGLSYSMLAAS 379

  Fly   387 L-----VISP--ALGNALMEMYG-----DTLVVALSTAIA------------LLDVFFI 421
            |     :|.|  .||.|    ||     ..|.:|:.|.:|            .|.:||:
  Fly   380 LWPLVALIIPEYQLGTA----YGFCQSIQNLGLAVITIVAGIIVDHSGGEHMWLQLFFM 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 46/189 (24%)
MFS_1 257..601 CDD:284993 46/189 (24%)
mrvaNP_001261505.1 MFS 55..448 CDD:119392 46/189 (24%)
MFS_1 58..410 CDD:284993 40/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.