DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and CG8008

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster


Alignment Length:457 Identity:92/457 - (20%)
Similarity:160/457 - (35%) Gaps:139/457 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 ISTLNQTFPDHTFLMNGLVMGIKGILSFLSAPLIGALSDIWGRKFFLLVTVFFTCLPIPLMS--- 336
            |.|..|.:..:.||...|   ::.|:.......||:.||.:|||..|:|::........:|:   
  Fly    81 IETELQPYVANLFLARTL---LESIVPAFCGLFIGSWSDHYGRKPLLIVSMIGFSASFLMMAAIC 142

  Fly   337 -------INTWWFFAMI---SISGAFAVTFSVVFAYVADVTTPEERSKAY-----------GLAS 380
                   :|.||:....   |:.|...|.....|.:::|:|  :.:|:.|           ||.|
  Fly   143 ELSSYYVVNPWWYIMAAVPHSLLGGNCVFSVAAFCFISDIT--DCKSRPYRMIFMESLFFIGLTS 205

  Fly   381 ATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESL---SEKMRPASWGAPI 442
            .:..:|.|.: |:|:|        ..:.:|..|......||:..|||||   .|:....:..|.:
  Fly   206 GSLLSSFVYA-AVGSA--------ATIGISGCIVTFATLFIIFFVPESLHFHKEQETKNAITANV 261

  Fly   443 SWEQADP---------------------FLALRKVGTDKTV-LMLCLTVLLSY-----------L 474
            ..|..|.                     |:...:.|.||.: |....|..:|:           |
  Fly   262 EKECIDSKVPITACDLQLDRVAIDCPPNFMNDEEPGKDKRMELPTPATPAMSFDDDLLAKYVERL 326

  Fly   475 PE----------------AGEYSCMFVYLKLKMGFN-----------YVEVSVFIAIV---GILS 509
            |:                ||.:|.:.:...:...|.           .|.:::|::|.   |:::
  Fly   327 PQKAEERKRQEAEEQAKKAGLFSMVHIRDMISTCFKRRDHHARAIIWLVTLAMFLSIFVFDGVMT 391

  Fly   510 I----------------TVQVTLGSFMQVFGAK----------RTIIMGLAL-----EIVQLLWY 543
            :                |...|:...:.:.||.          |..::.|||     ||:..|..
  Fly   392 VMYLFVREKFHWTVRDYTFFETVSHLVPMIGALIGFLILRKVFRLSVVTLALLAFFSEILNNLAK 456

  Fly   544 GFGSQKWMMWSAGVVAALGSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVF 608
            ||.:..|.|:.:..:....||:.|.....||....|..    .|.|..::.:.....|.|...::
  Fly   457 GFATMPWHMYLSVTLGVFRSISGPMCRTIVSNIVPPSD----LGKIFSIKNVLQSFAPFVAAPLY 517

  Fly   609 YL 610
            .|
  Fly   518 TL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 92/457 (20%)
MFS_1 257..601 CDD:284993 89/446 (20%)
CG8008NP_001137623.1 MFS 101..547 CDD:119392 86/434 (20%)
MFS_1 101..>261 CDD:284993 41/170 (24%)
MFS_1 375..>558 CDD:284993 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.