DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and CG12194

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001162873.1 Gene:CG12194 / 33685 FlyBaseID:FBgn0031636 Length:496 Species:Drosophila melanogaster


Alignment Length:214 Identity:47/214 - (21%)
Similarity:79/214 - (36%) Gaps:71/214 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 GEPSVHHALVVIFLEFF-------AWGLLTMPIISTLNQTF--------PDHTFLMNGLVMGIKG 298
            ||.:....:|...|:|:       |:.:...|.:: |.|.|        ||....:|.:|.    
  Fly   264 GELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVA-LGQAFFVSNFHMTPDEANTVNSIVY---- 323

  Fly   299 ILSFLSAPLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTWWFFAMIS-ISGAFAVTFSVVFAY 362
            ::|.:::||.|.:.|..||..                   ||.|.|.|| :...|.:||:.:..|
  Fly   324 LISAIASPLFGFVIDKVGRNV-------------------TWVFCATISTLLAHFLLTFTHLDPY 369

  Fly   363 V-------------------ADVTTPE-ERSKAY---------GLASATFAASLVISPALGNA-- 396
            :                   ..:..|| :...||         |||..|.||.:::..:.|:.  
  Fly   370 IGMSIMGLSYSMLAASLWPLVSLIVPEYQLGTAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFW 434

  Fly   397 LMEMYGDTLVVALSTAIAL 415
            |...:...|:|:|....|:
  Fly   435 LQVFFMSFLLVSLLATCAI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 45/207 (22%)
MFS_1 257..601 CDD:284993 45/206 (22%)
CG12194NP_001162873.1 MFS 61..454 CDD:119392 47/214 (22%)
MFS_1 64..416 CDD:284993 37/175 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.