DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and AgaP_AGAP005318

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_555956.2 Gene:AgaP_AGAP005318 / 3289944 VectorBaseID:AGAP005318 Length:472 Species:Anopheles gambiae


Alignment Length:381 Identity:88/381 - (23%)
Similarity:155/381 - (40%) Gaps:79/381 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 LVMGIKGILSFLSAPLIGALSDIWGRK-------------FFLLVTVFFTCLPIPLMSINTWWFF 343
            :::.||.::..|||.|:||.||.:|||             |.||..:.|..:.:   ::..|::.
Mosquito   107 VIVIIKSVVPVLSALLLGAWSDRYGRKPAMLIASAGVLCSFVLLTLLAFLSMQV---TLTPWYYT 168

  Fly   344 AM---ISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLVISPALGNALMEMYGDTL 405
            |.   .|:.|...|..:..|:|::|||..:.|:...|...|:..|..::.....:.::|......
Mosquito   169 AAYLPFSVLGGMTVITAAAFSYLSDVTNEQTRTMRMGFMEASMMAGALLGFLASSYIVEWLNVAA 233

  Fly   406 VVALSTAIALLDVFF--------ILVAVPESLSEKMRPASWGAPISWEQ----ADPFLALRKVGT 458
            ...:::.:.||.:.:        |:::...|..||:|..     :|.|:    :..|. :|:.|.
Mosquito   234 TFLIASVLILLAIVYIARFTEDSIILSNSNSAVEKLRDL-----LSCERLRELSGTFF-MRRSGY 292

  Fly   459 DKTVLMLCLTVLLSYLPE--AGEYSCMFVYLKLKMG-----FNYVE-VSVFIAIVG-ILSITVQV 514
            .:.:|.  ..|||:.|.|  .|.....:::.:.|.|     |:|.: ..|.|.|.| ::.|.:  
Mosquito   293 VREILW--SIVLLTGLTELAGGSGGVFYMFTRRKFGWDLKQFSYFQFTDVLIIIFGNVIGIPI-- 353

  Fly   515 TLGSFMQVFGAKRT--IIMGLALEIVQLLWYGFGSQKWMMWSAGVVAALG-----------SITY 566
                ..|:.....|  .|:.:|..||..|..||.|..||::.|..|..|.           |...
Mosquito   354 ----LKQILHCSDTTVAIVSIASYIVDSLIMGFASSGWMLYLAISVTVLKGTDGAALMTICSTIL 414

  Fly   567 PA------------ISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVFYL 610
            ||            ::|.|.|.:||.........|..:..:.|.:..:|:|....|
Mosquito   415 PAGDMAKFFTMALSLTAVVPLVSAPLFTFVYNATIESLPEVFNFVAASVYGAALLL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 88/381 (23%)
MFS_1 257..601 CDD:284993 85/370 (23%)
AgaP_AGAP005318XP_555956.2 MFS 109..256 CDD:304372 34/149 (23%)
MFS_1 113..438 CDD:284993 79/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.