DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and CG15890

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001285245.1 Gene:CG15890 / 32401 FlyBaseID:FBgn0030576 Length:599 Species:Drosophila melanogaster


Alignment Length:349 Identity:81/349 - (23%)
Similarity:141/349 - (40%) Gaps:92/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 PLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVTFSVVFAYVADVTTPE 370
            |::|....:.|    |::.|:|...|:...::....|   .|:||.:......||:|:||:||.|
  Fly   171 PVVGEFLGVVG----LMLCVYFEQAPMEAAALTEAIF---PSLSGGWFTMLMGVFSYIADITTEE 228

  Fly   371 ERSKAYGLASATFAASLVISPALGNALMEMYGDTLVVALSTA---IALLDVFFILVAVPESLSEK 432
            :|:...|:.:..|:..:.|..|....|::..|...|.::|.|   ||.:..||.| ..|:|..||
  Fly   229 DRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAFVYGFFFL-EEPQSRPEK 292

  Fly   433 MRPASWGAPISWEQ----ADPF----------LALRKVGTD---KTVLMLCLTVLLSYLPEAGEY 480
                      |.||    ||.|          :|.:| |.:   |.|::|.:.|::...|..||.
  Fly   293 ----------SAEQKSLLADFFDKEHVVQTFRVAFKK-GENQRRKRVILLMIVVMVIIGPLHGEM 346

  Fly   481 SCMFVYLKLKMGFNYVEVSVFI--------------------------AIVGILSITVQVTLGSF 519
            :..:::.:.:..::.||.|.|.                          |:||:||.|.:: |.||
  Fly   347 AVTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCVGILSHKLNIDDALVGVLSSTSKI-LSSF 410

  Fly   520 MQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAGVVAALGSITYPAISAFVSLYAAPESQGA 584
            :                      |.|.:..|.|:..|:|.......:.|:.:..:...:.:..|.
  Fly   411 V----------------------YAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGK 453

  Fly   585 VQGMITGMRGLCNGLGPAVFGVVF 608
            |..:.    |:...|.|.||..::
  Fly   454 VNSLF----GVAEALMPMVFAPMY 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 81/349 (23%)
MFS_1 257..601 CDD:284993 78/340 (23%)
CG15890NP_001285245.1 MFS 135..507 CDD:119392 81/349 (23%)
MFS_1 135..470 CDD:284993 80/344 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.