DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and Slc46a2

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001100122.1 Gene:Slc46a2 / 298034 RGDID:1310485 Length:480 Species:Rattus norvegicus


Alignment Length:377 Identity:82/377 - (21%)
Similarity:150/377 - (39%) Gaps:66/377 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 FLMNGLVMGIKGILSFLSAPLIGALSDIWGRKF--------FLLVTVFFTCLPIPLMSINTWW-- 341
            :::..||:|:..:   |||.::|.|||.:.||.        |||..:..      |:.:...|  
  Rat    80 YIIYNLVVGLTPL---LSAYVLGWLSDRYHRKISICTAMLGFLLSRIGL------LLKVMLDWPL 135

  Fly   342 -----FFAMISISGAFAVTFSVVFAYVADVTTPEERS-------KAYGLASATFAASLVISPALG 394
                 ..|:..:.|.|:..:|.|.|..:...:...||       ...|||.  |..|:    |.|
  Rat   136 EVMYGAAALNGLCGGFSAYWSGVMALGSLSCSQSRRSVRLILIDLVLGLAG--FCGSM----ASG 194

  Fly   395 NALMEMYGDT----LVVALSTAIALLDVFFIL--VAVPESLSE--KMRP------ASWGAPISWE 445
            :...::.|.:    |:.|.|...|...:|:.|  :.|||::|:  |:.|      ...|...:.:
  Rat   195 HLFKQIVGHSAQGLLLTACSVGCAAFALFYSLFVLKVPEAVSKPNKVHPTVDTVSGMMGTYRTLD 259

  Fly   446 ---------QADPFLALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVY-LKLKMGFNYVEVSV 500
                     ||:|....::..:...:.:|.:..::..|...|....|.:: ||..:.:|.|::..
  Rat   260 PDQQDKPNIQANPPTPGKEKPSQAIIALLFVGAIVYDLAVVGTLDVMALFVLKDPLHWNQVQLGY 324

  Fly   501 FIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAGVVAALGSIT 565
            .:|...|:.||..:.:..|.:.|.....||:|:.......|...|..:.:|.:.|..|.....|.
  Rat   325 GMASGYIIFITSFLGVLVFSRYFRDTTMIIIGMVSFGSGALLLAFVKKTYMFYIARAVMLFALIP 389

  Fly   566 YPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVF-YLFNVDLN 616
            ...|.:.:|......|.|.:..::.    ||..|...|...:: .::.:.||
  Rat   390 ITTIRSAMSKLVKDSSYGKIFVILQ----LCLALTGVVTSTMYNKIYQLTLN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 80/371 (22%)
MFS_1 257..601 CDD:284993 79/359 (22%)
Slc46a2NP_001100122.1 MFS 86..433 CDD:119392 79/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.