DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and Slc46a3

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001020139.1 Gene:Slc46a3 / 288454 RGDID:1307594 Length:461 Species:Rattus norvegicus


Alignment Length:376 Identity:73/376 - (19%)
Similarity:132/376 - (35%) Gaps:130/376 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 MNGLVMGIKGILSFLSAPLIGALSDIWGRKFFLLV-------TVFFTC------LPIPLMSINTW 340
            ::||:.|:......||:      ||..|||..:::       |..:.|      ||:.|:..:|:
  Rat    78 ISGLIPGLVSTFMLLSS------SDNHGRKLPMVLSSLGSLGTNLWLCAMSYFDLPLQLLVASTF 136

  Fly   341 WFFAMISISGAFAVTFSVVFAYVAD---------------------VTTPEERSKAY-----GLA 379
                :.::.|.:...:...|||:.|                     ||.....|..|     |.|
  Rat   137 ----IGALFGNYTTFWGACFAYIVDQEKEYKHRIIRIAVLDFMLGVVTGLTGLSSGYFIRELGFA 197

  Fly   380 SATFAASLVISPALGNALMEM-----YGDTLVVALSTAIALLDVFFILVAVPESLSEKMRPA--- 436
            .:.|..::|:...|...|..:     ...:.:|.:|.:.:|.|:|:....:.::.|.|.|..   
  Rat   198 WSYFIIAVVVLVNLAYILFFLSDPIKESSSQIVTMSCSESLKDLFYRTYMLFKNGSCKRRSLLCL 262

  Fly   437 ----------------------SWGAPISWEQADPFLALRKVGTDKTVLMLCLTVLLSYLPEAGE 479
                                  ..|.|:.|.:                      |.:.|....|.
  Rat   263 LIFTLVVYFFVVFGITPVFTLYELGPPLCWNE----------------------VYIGYGSALGS 305

  Fly   480 YSCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLA---------- 534
            .|.:..:|.:.: |:|....:.||.|||.:..|.:.|.:|     .:.|::|.|.          
  Rat   306 LSFLSSFLGIWL-FSYCLKDIHIAYVGIFTTMVGMMLTAF-----TRTTLMMFLVRISFFFTIMP 364

  Fly   535 LEIVQLLWYGFGSQKWMMWSAGVVAA-------LGSITYPAISAFVSLYAA 578
            |.|::.:.    |:.......||:.|       ||.:|  :.||:..:|:|
  Rat   365 LSILRSML----SKVVHSTEQGVLFACIAFLETLGGVT--STSAYNGIYSA 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 73/376 (19%)
MFS_1 257..601 CDD:284993 73/376 (19%)
Slc46a3NP_001020139.1 MFS 3..437 CDD:421695 73/376 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.