DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and SLC46A3

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001129391.1 Gene:SLC46A3 / 283537 HGNCID:27501 Length:463 Species:Homo sapiens


Alignment Length:404 Identity:82/404 - (20%)
Similarity:141/404 - (34%) Gaps:142/404 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 IFLEFFAWGLLTMPIIS----------TLNQTFPDHTFLMN-----------------------G 291
            |||..||. .||.|:.:          |.|.||...:.:..                       .
Human    10 IFLSAFAM-TLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFN 73

  Fly   292 LVMGIKGIL-SFLSAPLIGALSDIWGRKFFL-------LVTVFFTCL------PIPLMSINTWWF 342
            |.|.|.|:: ..:|..::.::||.:||||.:       |.|..:.||      |..|:..:|:  
Human    74 LQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLIASTF-- 136

  Fly   343 FAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLV---ISPALGNALMEM--YG 402
              :.:..|.:...:...|||:.| ...|.:.|...:|...|...||   ...:.|..:.|:  ..
Human   137 --IGAFCGNYTTFWGACFAYIVD-QCKEHKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEW 198

  Fly   403 DTLVVALSTAIALLDV-FFILVAVPESLSEKMRPASWGAPISWEQADPF-------LALRKVGTD 459
            ..|::|:|.|:.|:.: ||:...|.|..|:.         ::...::.|       ..|.|..:.
Human   199 SFLIIAVSLAVNLIYILFFLGDPVKECSSQN---------VTMSCSEGFKNLFYRTYMLFKNASG 254

  Fly   460 KTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFG 524
            |...:|||.:                         :..::.|..::||..|.:...|.|      
Human   255 KRRFLLCLLL-------------------------FTVITYFFVVIGIAPIFILYELDS------ 288

  Fly   525 AKRTIIMGLALEIVQLLW----YGFGSQKWMMWSAGVVAALGSITYPAISAFVSL----YAAPES 581
                          .|.|    .|:||            ||||.::  :::|:.:    |...:.
Human   289 --------------PLCWNEVFIGYGS------------ALGSASF--LTSFLGIWLFSYCMEDI 325

  Fly   582 QGAVQGMITGMRGL 595
            ..|..|:.|.|.|:
Human   326 HMAFIGIFTTMTGM 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 82/404 (20%)
MFS_1 257..601 CDD:284993 82/404 (20%)
SLC46A3NP_001129391.1 MFS_1 81..399 CDD:311564 66/332 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.