DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and Slc35a3

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_006501488.1 Gene:Slc35a3 / 229782 MGIID:1917648 Length:338 Species:Mus musculus


Alignment Length:298 Identity:53/298 - (17%)
Similarity:93/298 - (31%) Gaps:92/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 ALGNALMEMYGDTLVVALSTAIAL-------LDVFFILVAVPESLSEKMRPASW---------GA 440
            |:.:.:..:..:.|.||||...|.       |.:....:.....|.:|:....|         .|
Mouse   100 AIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVA 164

  Fly   441 PISWEQADPFLALRKVGTDKTV--LMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIA 503
            .:.|......|..:.:.|....  ||..||..         :|..|..:..:......:.||:|.
Mouse   165 FVQWPSDSQELNSKDLSTGSQFVGLMAVLTAC---------FSSGFAGVYFEKILKETKQSVWIR 220

  Fly   504 IVGILSITVQVTLGSFMQVFGAKRTIIMGLAL---EIVQL--LWYGFGSQKWMMWSAGVVA--AL 561
                     .:.||.|..:||     :||:.:   |:|..  .:.|:....|:     |||  ||
Mouse   221 ---------NIQLGFFGSIFG-----LMGVYVYDGELVSKNGFFQGYNQLTWI-----VVALQAL 266

  Fly   562 GSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVFYLFNVDLNDDHDSHAKSS 626
            |.:...|:..:..               ..::|....|...:..::.|.:               
Mouse   267 GGLVIAAVIKYAD---------------NILKGFATSLSIILSTIISYFW--------------- 301

  Fly   627 GSRATNVEKISQHVPGPPFVFGALCVFCAIIVSAFIPE 664
                     :...||...|..||:.|..|..:..:.|:
Mouse   302 ---------LQDFVPTSVFFLGAILVIAATFLYGYDPK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 45/244 (18%)
MFS_1 257..601 CDD:284993 44/233 (19%)
Slc35a3XP_006501488.1 Nuc_sug_transp 13..326 CDD:282054 52/292 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.