DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and srf-3

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001255676.1 Gene:srf-3 / 187393 WormBaseID:WBGene00005153 Length:368 Species:Caenorhabditis elegans


Alignment Length:277 Identity:62/277 - (22%)
Similarity:102/277 - (36%) Gaps:83/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 CLPIPLMSI-NTWWFFAMISISGA-FAVT-----FSVVFAYVADVTTPEERSKAYGLASATFAAS 386
            |:|..:..: |..::.|...:..| |.:|     |:.....|..:.....|::.:.||......|
 Worm   121 CIPAMIYIVQNNLFYVAASHLDAATFMITSQLKIFTAAIFTVIILRRSLNRTQWFALAVLFVGVS 185

  Fly   387 LVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPESLS-------EKMRPASWGAPISW 444
            ||  ...|....|..|::..|.           |:.|.|...||       ||:...|  ||:| 
 Worm   186 LV--QLQGTKAKESSGESPFVG-----------FVAVVVACCLSGFAGIYFEKILKGS--APVS- 234

  Fly   445 EQADPFLALRKVGTDKTVLMLCLTVLLSYLPEA---GEYSCMFVYLKLKMGFNYVEVSVFIAI-- 504
                  |.:|.|  ...|..:..:....|:.::   .||..::       ||:.:   |::.:  
 Worm   235 ------LWMRNV--QMAVFSIPASFSAIYMQDSKTVNEYGLLY-------GFDSI---VWLTVLW 281

  Fly   505 --VGILSITVQV-------------------TLGS-FMQVFGAKRTIIMGLALEIVQLLWYGFGS 547
              ||.||:.|.:                   |:|| |:..|....|.::|.:|.|..:..|  .|
 Worm   282 YGVGGLSVAVCIKYADNIAKNFATSVAIILSTIGSIFLFDFIPSFTFLLGASLVIFSIFLY--SS 344

  Fly   548 QKWMMWSAGVVAALGSI 564
            .:.|      |||||.:
 Worm   345 HQSM------VAALGRL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 62/277 (22%)
MFS_1 257..601 CDD:284993 62/277 (22%)
srf-3NP_001255676.1 Nuc_sug_transp 40..343 CDD:282054 55/257 (21%)
EamA 119..342 CDD:304911 54/254 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.