DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and slcr-46.1

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001033534.2 Gene:slcr-46.1 / 180736 WormBaseID:WBGene00016705 Length:481 Species:Caenorhabditis elegans


Alignment Length:373 Identity:70/373 - (18%)
Similarity:130/373 - (34%) Gaps:105/373 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 LIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTW---------WFF---AMISISGAFAVTFSVV 359
            :.|..||..|||:.:|:.: .:.|....|:|..|         |.:   .:..:.|.|.:|.|.:
 Worm    88 IYGGYSDHRGRKYPMLIGI-LSVLVSNAMNILMWDENTDWPLAWTYPTAVVTGVLGDFLLTMSCI 151

  Fly   360 FAYVADVTTPEERSKAYGLASA-------------------------------------TFAASL 387
            .||:|| ..|::.:.:|.:...                                     ||..||
 Worm   152 NAYIAD-EFPDKITLSYRMVVVSIIFSLGSFVASRFVKDLVKWTSKPTVMIIAEGGYLLTFLVSL 215

  Fly   388 VI----SPALGNALMEMYGDTLVVAL-------------STAIALLDVFFIL----VAVPESLSE 431
            :|    .|...|.|::  .|..:|.:             ||....|.||.|:    ||:.::...
 Worm   216 LILDQKKPKTKNCLLK--EDESIVTVEGSENQSLASLPNSTQENKLSVFEIIKTSFVAIYDAAKI 278

  Fly   432 KMRPASWGAPISWEQADPFLALRKVGTDKTVLMLCLTV-LLSYLPEAGEYSCMFVYLKLKM---- 491
            .::|                   :.|..:..|.||... .|.......|...:..|::|..    
 Worm   279 FLQP-------------------RAGHRRLFLYLCFAANFLDQFVWGEEKGLLGTYVRLPPFTWD 324

  Fly   492 GFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQ--LLWYGFGSQKWMMWS 554
            ...|.:...:..||.|:.:.|.:..  |.::|..:.|.|:.||:..:.  :|..|.....|::::
 Worm   325 TSTYADYKSWRPIVQIVGMAVGMLF--FKRIFHFRDTFIICLAILSMTGCVLMIGLAQASWLIFA 387

  Fly   555 AGVVAALGSITYPAISAFVSLYAAPESQG---AVQGMITGMRGLCNGL 599
            :....:|..:..|....|::.....:..|   |:..:...:.|:...|
 Worm   388 SLAPGSLHGLLNPMSYTFIACIVEQDEIGKAYAISSVAQKLAGIAQSL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 70/373 (19%)
MFS_1 257..601 CDD:284993 70/373 (19%)
slcr-46.1NP_001033534.2 NAGidase <5..116 CDD:369423 8/28 (29%)
MFS 72..471 CDD:391944 70/373 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.