DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and AgaP_AGAP000387

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_310718.5 Gene:AgaP_AGAP000387 / 1271863 VectorBaseID:AGAP000387 Length:359 Species:Anopheles gambiae


Alignment Length:127 Identity:29/127 - (22%)
Similarity:49/127 - (38%) Gaps:39/127 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 GIKGILSFLSAPLIGALSDIWGRKFFLLVTVFFTCLPIPLM--SINTWWFFAMISISGAFAVTFS 357
            |:.||  :....|.||...||.|.    :.:....||..|:  ::|..   |.::..|.|     
Mosquito   202 GLAGI--YFEKMLKGADISIWMRN----IQLSLLSLPFGLLTCAVNDG---AQLAARGFF----- 252

  Fly   358 VVFAYVADVTTPEERSKAYGLASATFAASLVISPALGN---ALMEMYGDTLVVALSTAIALL 416
              |.|.|                  |...||:..|:|.   |::..|.|.::...:|::|::
Mosquito   253 --FGYDA------------------FVVYLVVLQAVGGLIVAVVVKYADNILKGFATSLAII 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 29/127 (23%)
MFS_1 257..601 CDD:284993 29/127 (23%)
AgaP_AGAP000387XP_310718.5 Nuc_sug_transp 8..327 CDD:282054 29/127 (23%)
EamA 90..326 CDD:304911 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.