DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and si:ch211-262i1.4

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_021328126.1 Gene:si:ch211-262i1.4 / 101884492 ZFINID:ZDB-GENE-140106-10 Length:351 Species:Danio rerio


Alignment Length:369 Identity:68/369 - (18%)
Similarity:127/369 - (34%) Gaps:108/369 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 MNGLVMGIKGILSFLSAPL----IGALSDIWGRKFFLL------------VTVFFTC-LPIPLMS 336
            |:...:.|:.:||.:.|.|    :..::|..|.|.||:            :.:|..| :|:..:.
Zfish    48 MSSRFLLIQSVLSSVMAMLSIIPLSRMADHHGPKVFLVSSQMGSVLGMFTLVIFMYCEVPLEFLY 112

  Fly   337 INTWWFFAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLVISPALGNALMEMY 401
            :.:    .:..:||...:.::.|.|..:..:...:|:....:....|..:.|:...|...|.::.
Zfish   113 LGS----LLHGLSGGGPMFWAGVAALASLSSEQRKRTLKLNIVDFCFGIAGVVGGLLSGYLYQVG 173

  Fly   402 GDTLVVA--LSTAIALLDVFFILVAVPESLSEKM------------RPASWGAPISWEQADPFLA 452
            ...|::.  |.|.:|||...|.|.....|.||.|            :|     |:||:       
Zfish   174 PSVLLLTAILITTVALLYSVFALSDSRLSYSEGMVGAENVLQLFVLKP-----PLSWD------- 226

  Fly   453 LRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLG 517
                           :|...|    |..:...:||           |.|:|::            
Zfish   227 ---------------SVWAGY----GRAATSAMYL-----------SSFLAVL------------ 249

  Fly   518 SFMQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSA---GVVAALGSITYPAIS--AFVSLYA 577
            |...|.|.....::|:......:....|..:.|:.:..   |::..|.::| ..:|  .|.|:|.
Zfish   250 SLFNVMGDTALTLLGIVSNCTGMAIMAFTMESWIYFLGRVFGLLQLLLAVT-DLLSNVCFTSIYP 313

  Fly   578 APESQGAVQGMITGMRGLCNGLGPAVFGV----VFYLFNVDLND 617
            .         .:....|.|..|..|:..:    :.||....|.|
Zfish   314 L---------TLRWFSGFCFILSCAISYISAVPIIYLSGRTLRD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 66/362 (18%)
MFS_1 257..601 CDD:284993 63/347 (18%)
si:ch211-262i1.4XP_021328126.1 MFS_1 57..342 CDD:331686 63/352 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.