DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and LOC101731380

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_031755164.1 Gene:LOC101731380 / 101731380 -ID:- Length:414 Species:Xenopus tropicalis


Alignment Length:363 Identity:70/363 - (19%)
Similarity:125/363 - (34%) Gaps:118/363 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 GLVMGIKGILSFLSAPLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVT 355
            ||::..|.|:..|..|::..::...|   :.|..:|...:.:|.:            :..|||.:
 Frog    60 GLLLASKAIVQILFNPIVSLITYRLG---YELPMIFGFIITLPSI------------LLFAFASS 109

  Fly   356 FSVVF------------------AYVAD-VTTPEERSKAYGLASATFAASLVISPALGNALMEMY 401
            :|::|                  |.:|: .|..:||.:|.|:|....|..||..|..|:|:....
 Frog   110 YSLLFVARSLQGIGTSFTSVSGMAILANKYTDDKERGEAMGIALGGVALGLVAGPPFGSAMYAFV 174

  Fly   402 GDTLVVALSTAIALLD-VFFILVAVPESLSEKMRPASWGAP----------------------IS 443
            |......:..|:.||| ...:|:..|    .|..|.:..||                      :.
 Frog   175 GKASPFLILAALTLLDGALRLLILTP----SKTAPLTIAAPAFCALLKDPYIVLAAGSICLTNMV 235

  Fly   444 WEQADPFLALRKVGTDKT--------------VLMLCLTVLLSYLPEAGEYSCMFV--------Y 486
            ...|:|.|.:..:||..|              ..::|..:|.....:.|.:.|..:        :
 Frog   236 IAMAEPTLPVWMLGTMCTPDWLLGIVFFPASISYLVCTNLLPRLSQKIGRWLCSLLGMVLAGISF 300

  Fly   487 LKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFM---------QVFGAKRTI------------- 529
            |.:.:..|:..:...||..||....|.|::...|         .|:|....|             
 Frog   301 LCVPLAVNFYGLITPIAAFGISIGMVDVSMVPLMAYLVDLRHSSVYGGVYAISDIALNLGFAVGP 365

  Fly   530 -IMGLALEIVQLLWYGFGSQKWMMWSAGVVAALGSITY 566
             :.|:..:.:.|        .|:|    |:.|:.:|.|
 Frog   366 CVAGITAKAIGL--------PWLM----VIIAVLNIMY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 70/363 (19%)
MFS_1 257..601 CDD:284993 70/363 (19%)
LOC101731380XP_031755164.1 MFS_SLC18A1_2_VAT1_2 54..399 CDD:340942 70/363 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.