DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and slc35a5

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_031752663.1 Gene:slc35a5 / 100490140 XenbaseID:XB-GENE-1003413 Length:441 Species:Xenopus tropicalis


Alignment Length:370 Identity:68/370 - (18%)
Similarity:121/370 - (32%) Gaps:135/370 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LSDIWGRKFFLLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVTFSVVFAYVADVTTPEERSKA 375
            :|::|           :.|      .:|..|      :|.::..|..:.||||:           
 Frog    26 MSNMW-----------YKC------CLNRAW------LSRSYLHTLLLAFAYVS----------- 56

  Fly   376 YGLASATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAV------------PES 428
              |.|:..   |::..:........|..|.|...:.|:.||  |.::::|            ..|
 Frog    57 --LGSSRV---LLVKFSANEDNTYDYVPTTVNVCAEAVKLL--FCMVMSVRIIMKERRSFRCHAS 114

  Fly   429 LSEKMRPASWGAPISWEQADPFLALRKVGTDKTVLMLCLTVLLSYL-PEAGEYSCMFVYLKLKMG 492
            |.|..:...|..|       .||..    .|..::.    .:|:|| |........||.:.....
 Frog   115 LKEFFQYMKWAVP-------AFLYF----LDNLIIF----YILAYLQPAMAVLLSNFVIITTAFF 164

  Fly   493 FNYV---EVS---------VFIAIVGILSIT------VQVTLGSFMQVFGAKRTIIMGLALE--- 536
            |.::   ::|         :|::|:|:.|..      |.|.:...:.......:.|....|:   
 Frog   165 FRFILKRQLSCVQWASLLILFLSIMGLTSQNDTAHQEVSVNIHHHLFHSAPSNSCIYPKKLDTEA 229

  Fly   537 -------IVQLLWYGFGSQKWMMWSAGVVAALGSITYPAI---------SAFV---SLYAAPESQ 582
                   |....::..|...:::....|::||.:|....|         |.|:   .||      
 Frog   230 HTVSLKAIANFQYFHLGIGHFLILLQCVISALANIYNEKILKEGEQISESIFIQNSKLY------ 288

  Fly   583 GAVQGMITGMRGLCNGLGPAVFGVVFYLFNVDLNDDHDSHAKSSG 627
                                ||||:|....:.|:::|.|..||.|
 Frog   289 --------------------VFGVLFNGLTLVLHEEHFSKIKSCG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 62/353 (18%)
MFS_1 257..601 CDD:284993 57/342 (17%)
slc35a5XP_031752663.1 Nuc_sug_transp 52..390 CDD:398009 61/321 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.