DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11537 and LOC100002406

DIOPT Version :9

Sequence 1:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_017213485.1 Gene:LOC100002406 / 100002406 -ID:- Length:424 Species:Danio rerio


Alignment Length:318 Identity:70/318 - (22%)
Similarity:124/318 - (38%) Gaps:50/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 IKGILSFLSAPLIGALSDIWGRKFFLLVTV--FFTCLPIPLMSINTWWFFAMI-------SISGA 351
            |...:.||.|.|:..:.|...||..::|.:  :|....:.|:.:...|...::       .:.|.
Zfish    57 IAKFMPFLPAILLAKVGDRGYRKVPIVVPLVGYFLSRGLLLLDVAFDWPLQVLYAVPVIHGLCGG 121

  Fly   352 FAVTFSVVFAYVADVTTPEERSKA-------YGLASATFAASLVISPALGNALMEMY-------- 401
            ||..::.|.|.|:..:..||||.:       ||:|.  |..||    |.|: |..:|        
Zfish   122 FASYWAGVMALVSVSSGEEERSVSIMMTELVYGIAG--FIGSL----ASGH-LFALYTVNLKQGV 179

  Fly   402 ---GDTLVVALSTAIALLDVFFILVAVPESLSEKMRPASWGAPISWEQADPFLALRKVGTDK-TV 462
               |.::|:.|  ...|....|:.|..|..|.:::           |:.:.|..:.....|| .:
Zfish   180 ILSGSSVVLYL--LCLLYAATFLRVGPPAVLGDRL-----------ERRESFGIINHEARDKINI 231

  Fly   463 LMLCLTVLLSYLPEAGEYSCMFVY-LKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAK 526
            .:|.::.:|..:..||....:..| ||..:.:....|....|...:|.||..:.:..|.::....
Zfish   232 ALLFVSGILYDIAVAGGMEMLAAYVLKEPLNWGATLVGYGNAAGSLLFITSFLGVKMFTRLSLRD 296

  Fly   527 RTIIM-GLALEIVQLLWYGFGSQKWMMWSAGVVAALGSITYPAISAFVSLYAAPESQG 583
            .::|| |:......:.:..|.:...|.:.|..|.....|..|.|.:.:|......|.|
Zfish   297 ESMIMVGMVSFATGIYFMAFVTTTPMYFLARSVTLFALIPMPTIRSLLSKQVKGTSYG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11537NP_001097489.1 MFS 256..612 CDD:119392 70/318 (22%)
MFS_1 257..601 CDD:284993 70/318 (22%)
LOC100002406XP_017213485.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.