DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Chi3l1

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:406 Identity:187/406 - (46%)
Similarity:250/406 - (61%) Gaps:25/406 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 AAAAGGAAVAAGGTA---LVASGSSLKGKKTKVDDGTPKIVCYYTNWSQYRVKIGKFVPEDIPAD 150
            |.|..|..||..|.|   |:.|.|:.            |:|||||||||||...|...|:.:...
  Rat     5 AEARMGMRVALTGFAVLMLLQSCSAY------------KLVCYYTNWSQYREGNGSCFPDALDHS 57

  Fly   151 LCTHIIFAFGWLKKNKLSSYESNDETKDNVPGLYERMMTLKKANPKLKILLALGGWSFGTQKFKD 215
            ||||||::|..:..||||:.|.||.|      ||..:.|||..||:||.||::||||||:::|..
  Rat    58 LCTHIIYSFANISNNKLSTSEWNDVT------LYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSR 116

  Fly   216 MSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVLLLKELREAFEAEAQELKKPR 280
            :.|...:|:|||.|..||||..||||||:.|.|| |..||::|..|:|||:..|..|.|. ...:
  Rat   117 IVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYP-GPKDKQHFTTLIKELKAEFTKEVQP-GTEK 179

  Fly   281 LLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLS 345
            |||||||..|...:..||||..||.:|||||||.|||||.|...|||::||:....|:...:..:
  Rat   180 LLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSN 244

  Fly   346 VDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANPDKHGPNAPASGGGREGVYTKEGGFLAYYEIC 410
            ||......:::|||..|||:|:||:|:|||||:.:.. ..||.:|.|..|.||||.|.|||||||
  Rat   245 VDYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSENQ-VGAPITGSGLPGRYTKEKGTLAYYEIC 308

  Fly   411 EMLLNGAVYVWDDEMKVPYLVDGDQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVC 475
            :.|....|:....: :||:...|:||||:||..:::||:.::|:....|||||.:|:|||:|..|
  Rat   309 DFLRGAEVHRILGQ-QVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFC 372

  Fly   476 GGNVKYPLIGAMREEL 491
            |.||.:||..|::|.|
  Rat   373 GHNVHFPLTNAIKEAL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 164/343 (48%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 175/365 (48%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 164/343 (48%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 175/365 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm9066
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.