DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and CTS2

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_010659.1 Gene:CTS2 / 851977 SGDID:S000002779 Length:511 Species:Saccharomyces cerevisiae


Alignment Length:451 Identity:110/451 - (24%)
Similarity:193/451 - (42%) Gaps:102/451 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 YYTNWSQYRVKIGKFVPEDIPADLCTHIIFAF--------------GW------------LKKNK 166
            ||:|||.|:.:.  ..|.||.....:||.:||              .|            :|.::
Yeast    78 YYSNWSPYKPRF--HFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSE 140

  Fly   167 LSSYESNDETKDNVP-GLYERMMTLKK--ANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVY 228
            |....||:..::.:| |....:..||.  ::.|.|:::::|||| .::.||.:.......|.||.
Yeast   141 LIKESSNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSIGGWS-DSENFKIIIKDDKLLQNFVD 204

  Fly   229 SAIPFLRKRGFDGLDMDWEYPKGSD-DKKNFVLLLKELREAFEA-EAQELKK---PRLLLSAAVP 288
            |::..:.:.||||:|:|||:|..:: :.:.::.|::.||....: |:|...|   ....||.|.|
Yeast   205 SSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFGKRTEDHFQLSIAAP 269

  Fly   289 VGPDNIRGGYDVP--AIASYLDFINLMAYDFHGKWERETGHNAPLYAPS-TDSEWRKQLSVDNAA 350
            ...|.:   :.:|  .|..|:|:.|:|.||::|.|...||:::.|::.: .:..:.....:|   
Yeast   270 AFKDKL---FYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFSETELNGNFAMHYMID--- 328

  Fly   351 SLWVKMGAPKEKLVIGMPTYGRSF--------------TLANPDKHGPNAPA----SGGGREGVY 397
                :.|....|||:||..|||||              .|.|....|...|.    ...|:||::
Yeast   329 ----RFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIW 389

  Fly   398 TKEGGFLAYYEICEMLLNGAVYVWDDEMKVPYLVD--GDQWVGFDDERAIRNKMHWIKSNGFGGA 460
                   .|..:.::   |.:..:|.:....|..|  ...::.:|:.::::.|..::..|..||.
Yeast   390 -------PYKNLPKI---GTIEQYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGG 444

  Fly   461 MVWTIDMDDFKGEVCG---GNVKYPLIGAMREELLGISRGKEAKDVNWTAVAATFEDIEEK 518
            ..|         |.||   .|....||.|..|.|          ..|.::..:.|:|:..|
Yeast   445 FWW---------ESCGEAYANESRSLINAFNEGL----------HFNVSSKPSIFQDVRVK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 97/396 (24%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 105/422 (25%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
CTS2NP_010659.1 ChiA 36..474 CDD:225862 107/437 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I1191
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2365
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 1 0.900 - - OOG6_100224
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2066
SonicParanoid 1 1.000 - - X91
TreeFam 00.000 Not matched by this tool.
98.690

Return to query results.
Submit another query.