DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and ChiC

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana


Alignment Length:389 Identity:128/389 - (32%)
Similarity:184/389 - (47%) Gaps:44/389 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDET--KDNVPGLYERMMTLKKANP 195
            :.|.....:|...||.:.|.||:..||..|..      ::|..|  ..|.|.......|:::.||
plant    30 ASYWFPASEFPVTDIDSSLFTHLFCAFADLNS------QTNQVTVSSANQPKFSTFTQTVQRRNP 88

  Fly   196 KLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVL 260
            .:|.||::||.......:..|:|...:|::|:.|:|...|..||.|||:|||||..:.:..||..
plant    89 SVKTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGT 153

  Fly   261 LLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMAYDFHGK-WERE 324
            ||:|.|.|..|||....||||||:|||....:.....|.|.|:||.||::|||||||:|. |.|.
plant   154 LLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRV 218

  Fly   325 TGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANPDKHGPNAPAS 389
            ||..|.|:.||....     |.|.....|::.|.|.:|.|:|.|.||.::.|.|.:.|...||.:
plant   219 TGPPAALFDPSNAGP-----SGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTT 278

  Fly   390 GGGREGVYTKEGGFLAYYEICEMLL-NGAVYVWDDEMKVPYLVDGDQWVGFDDERAIRNKMHWIK 453
            |..     ....|.:.|.:|.:.:: |||..|::..:...|...|..|:|:||.::|..|:.:.|
plant   279 GAA-----ISPDGSIGYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAK 338

  Fly   454 SNGFGGAMVWTIDMDDFKGEVCGGNVKYPLIGAMREELLGISRGKEAKDVNWTAVAATFEDIEE 517
            ..|..|...|.:..||..                     |:||   |....|.|..||...|::
plant   339 QRGLLGYFSWHVGADDNS---------------------GLSR---AASQAWDATTATTRTIQK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 117/338 (35%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 119/361 (33%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 120/365 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68318
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.