DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and AT4G19760

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_193711.2 Gene:AT4G19760 / 827720 AraportID:AT4G19760 Length:369 Species:Arabidopsis thaliana


Alignment Length:332 Identity:101/332 - (30%)
Similarity:159/332 - (47%) Gaps:29/332 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 IPADLCTHIIFAFGWLKK-------NKLSSYESNDETKDNVPGLYERMMTLKKANPKLKILLALG 204
            |.:.|.||:..||..:..       :..:||:.:..|:           |:|:.|..::.||::|
plant    40 IDSTLFTHLFCAFADVDSSTHEVTISAANSYQFSSFTE-----------TVKEKNTDVQTLLSIG 93

  Fly   205 GWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVLLLKELREAF 269
            |..........|:|....|:.|:.|:|...||:.|.|||:.||||....:..||..||:|.|.|.
plant    94 GKDADKAVLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWEYPSNDVEMTNFGKLLEEWRAAV 158

  Fly   270 EAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMAYDFHGK-WERETGHNAPLYA 333
            ..|:.:..:..|||:|||...|......|.|.|||..|||:|:|||||:|. |...||..|.|:.
plant   159 VEESDKTNQLPLLLTAAVYYSPQYDGVEYPVKAIADNLDFVNIMAYDFYGPGWSPVTGPPAALFH 223

  Fly   334 PSTDSEWRKQLSVDNAASLWV-KMGAPKEKLVIGMPTYGRSFTLANPDKHGPNAPASGGGREGVY 397
            ..::...|   |.::....|: :...|.:|.|:|.|..|.::||.:.:.:|.:|     ..:|..
plant   224 DPSNPAGR---SGNSGLRKWLDEAKLPPKKAVLGFPYCGWAWTLEDAENNGYDA-----ATDGAA 280

  Fly   398 TKEGGFLAYYEICEMLL-NGAVYVWDDEMKVPYLVDGDQWVGFDDERAIRNKMHWIKSNGFGGAM 461
            ....|.:.|.:|...:: |||....|..:...|...|:.|:|:||.::|..|:.:.|..|..|..
plant   281 ISPDGSITYAKIRNYIVDNGAATFHDPAVIGFYCYVGNTWIGYDDNQSIVYKVKYAKFTGLLGYF 345

  Fly   462 VWTIDMD 468
            .|.:..|
plant   346 SWHVGAD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 100/330 (30%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 101/332 (30%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
AT4G19760NP_193711.2 GH18_plant_chitinase_class_V 11..358 CDD:119358 101/332 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68318
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.