DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and AT4G19750

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_193710.2 Gene:AT4G19750 / 827719 AraportID:AT4G19750 Length:362 Species:Arabidopsis thaliana


Alignment Length:354 Identity:109/354 - (30%)
Similarity:162/354 - (45%) Gaps:47/354 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VKIGKFV--PE-DIPA-----DLCTHIIFAFGWLKKN------------KLSSYESNDETKDNVP 181
            ||...:|  || |.||     ...||:..||..:..:            ::||:..         
plant    14 VKASYWVVKPENDFPAGNIDSTRFTHLFCAFADVDSSTHEVTISAANSCQVSSFTH--------- 69

  Fly   182 GLYERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDW 246
                   |:|..|..::.||::||..........|:|....|:.|:.|:|...||:.|.|||:.|
plant    70 -------TVKDKNTDVQTLLSIGGKDADKAVLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAW 127

  Fly   247 EYPKGSDDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFIN 311
            |||....:..||..|:||.|.|...|:....:..|||:|||...||.....|.|.|||..|||:|
plant   128 EYPSNDVEMANFGKLVKEWRAAVVEESDRTNQLPLLLTAAVYYSPDYYGEEYPVQAIADNLDFVN 192

  Fly   312 LMAYDFHGK-WERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFT 375
            :|||||:|. |...||..|.|:.||..:    ..|.|:..|.|::...|.:|.|:|....|.::|
plant   193 IMAYDFYGPGWSPVTGPPAALFDPSNPA----GRSGDSGLSKWLEAKLPAKKAVLGFSYCGWAWT 253

  Fly   376 LANPDKHGPNAPASGGGREGVYTKEGGFLAYYEICEMLL-NGAVYVWDDEMKVPYLVDGDQWVGF 439
            |.:.:.:|.:|     ..:|......|.:.|.:|...:: |||....|..:...|...|..|:|:
plant   254 LEDAENNGYDA-----ATDGAAISSDGSITYAKIRNYIIDNGAATFHDPAVIGFYCYVGTTWIGY 313

  Fly   440 DDERAIRNKMHWIKSNGFGGAMVWTIDMD 468
            ||.::|.:|:.:.|..|..|...|.:..|
plant   314 DDNQSIVSKVRYAKLKGLLGYFSWHVGAD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 108/352 (31%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 109/354 (31%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
AT4G19750NP_193710.2 GH18_plant_chitinase_class_V 11..348 CDD:119358 109/354 (31%)
Glyco_18 14..342 CDD:214753 108/352 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68318
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.