DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and AT4G19740

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:219 Identity:79/219 - (36%)
Similarity:109/219 - (49%) Gaps:11/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 MSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVLLLKELREAFEAEAQELKKPR 280
            |:|.|.:|::|:.|:|...|..||.|||:.||||....:..||..||:|.|.|.|.|:|......
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYPNNDVEMNNFGKLLQEWRSAVEVESQRTGIRP 65

  Fly   281 LLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLS 345
            |||:|||....|.....|.|.||...||::||:||:|:| ...|.|..|.||.||.     |...
plant    66 LLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYG-LTTEIGPPAGLYDPSI-----KGPC 124

  Fly   346 VDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANPDKHGPNAPASGGGREGVYTKEGGFLAYYEIC 410
            .|.....|:|.|.|::|.|.|.|..|.|:||.:...||.:...:    ..|.....|.:.|.:|.
plant   125 GDTGLKHWLKAGLPEKKAVFGFPYVGWSWTLDDDKDHGDDVAVT----HRVAVTANGSINYDQIV 185

  Fly   411 EMLLN-GAVYVWDDEMKVPYLVDG 433
            :.:.. .|..|:|.|:...|.:.|
plant   186 KFITEYKARTVYDSEVVGFYCIAG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 79/219 (36%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 79/219 (36%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 71/197 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68318
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.