DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and AT4G19720

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001319998.1 Gene:AT4G19720 / 827716 AraportID:AT4G19720 Length:363 Species:Arabidopsis thaliana


Alignment Length:344 Identity:101/344 - (29%)
Similarity:165/344 - (47%) Gaps:28/344 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 AKRPGAGKFQPEN----IDPKLCTHIVYAFATL----QDYKLTEATDDDPENYESVIALRDNNPD 625
            |..|..|...|::    ||..|.||:..|||.|    ....::.|.:.:..|:..::  :..||.
plant    16 ASSPTTGSVVPQSSAVLIDSTLFTHLFCAFADLDPQTNSVVVSGAHEQEFSNFTKIV--KKKNPH 78

  Fly   626 LQILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYPRGAEDRVAYVSL 690
            :|.||:|||.....:.|..:.||......|::.||...|.|:|:|||:.|:||:...:...:..|
plant    79 VQTLLSIGGRNADKSAFASMASNPTSRKSFIWSAISSARYYRFDGLDLVWKYPKDDVEMRNFGQL 143

  Fly   691 LKELRVAFEGEAKSSGLPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERTVG 755
            |::.|.|.|.:|:.:....|||||||..|....:..|.:.||.|.||::|::.|||:.. ..|:|
plant   144 LEQWREAIEDDAERTERMPLLLTAAVYYSPVYDSVSYPIREIKKKLDWVNLIAYDFYSS-STTIG 207

  Fly   756 HNSPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLIGMPTYGRSFELVNDTQFDIGSPSSGG 820
            ..:.||...:..|    ...||..:||:|.|.|.:|.::|.|..|.::.|           .||.
plant   208 PPAALFDPSNPKG----PCGDYGLKEWIKAGLPAKKAVLGFPYVGWTWSL-----------GSGN 257

  Fly   821 GKAGK--FTNEAGFLSYYEVCSFLAADNTTLVWDSEQQVPFAYRGNQWVGFDDERSLKTKTEWLK 883
            ..|..  .|:..|.::|.::...:.......|:||.....:.:.|...:|:||.:|:..|.::.|
plant   258 DAATSRVATSAEGSINYDQIKRLIVDHKARPVFDSTVVGDYCFAGTSLIGYDDHQSVVAKVKYAK 322

  Fly   884 EQGFGGIMVWSIDMDDFSG 902
            ::|..|...|.:..||..|
plant   323 QKGLLGYFSWHVGADDNFG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 98/338 (29%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 101/344 (29%)
CBM_14 951..1005 CDD:279884
AT4G19720NP_001319998.1 GH18_plant_chitinase_class_V 3..343 CDD:119358 101/344 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68318
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 1 0.900 - - OOG6_100224
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.