DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and ctbs

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001018565.1 Gene:ctbs / 553763 ZFINID:ZDB-GENE-050522-422 Length:361 Species:Danio rerio


Alignment Length:277 Identity:67/277 - (24%)
Similarity:110/277 - (39%) Gaps:57/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 RQTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVL--LLKELREAFEAEAQELKKPRLLLSA 285
            |..::...:...:.:..||:::|.|....:...:.:.|  |:||..|:|..|.     |...:|.
Zfish    99 RTAWIQGNVKLAKSQFMDGINIDIEQAVETGSPEYYALTDLVKETTESFHTEI-----PGSQVSF 158

  Fly   286 AVPVGPDNI-RGGYDVPAIASYLDFINLMAYDFHGK-WERETGH-----NAPLYAPSTDSEWRKQ 343
            .|...|..| :..||...||...|.:.:|:||...: |    |.     |||.....|       
Zfish   159 DVAWSPKCIDKRCYDYITIADSCDLLFVMSYDEQSQIW----GDCIAMANAPYDQTLT------- 212

  Fly   344 LSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANPDKHG----PNAPASG------GGREGVYT 398
                 |...::.|....:|||:|:|.||..::..|..|.|    |..|..|      .||:    
Zfish   213 -----AYDQYISMNIDPKKLVMGVPWYGYDYSCLNFSKDGVCTIPKVPFRGAPCSDASGRQ---- 268

  Fly   399 KEGGFLAYYEICEMLLNGAV--YVWDDEMKVPYLVDGD-----QWVGFDDERAIRNKMHWIKSNG 456
                  ..|.|....:|.::  .:||:|.:.||....|     ..|.:||..:|..|..::..:|
Zfish   269 ------IPYSIMMKQINSSISGRLWDEEQRAPYYNYKDTEGMVHQVWYDDPESIALKAAYVMQHG 327

  Fly   457 FGGAMVWTIDMDDFKGE 473
            ..|..:|..::.|:.|:
Zfish   328 LKGIGMWNGNLLDYNGD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 65/270 (24%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 67/277 (24%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
ctbsNP_001018565.1 GH18_chitobiase 5..358 CDD:119354 67/277 (24%)
Glyco_18 <95..334 CDD:214753 64/265 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.