DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and XB5763442

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:XP_031751817.1 Gene:XB5763442 / 548945 XenbaseID:XB-GENE-5763443 Length:486 Species:Xenopus tropicalis


Alignment Length:379 Identity:172/379 - (45%)
Similarity:236/379 - (62%) Gaps:16/379 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVPGLYERMM 188
            |:|||:|||:||...:.:::|:|:...:|||:|:||..:..|:::.:|.||      |..|....
 Frog    23 KLVCYFTNWAQYYPGVAQYMPDDVDPCMCTHLIYAFATMTNNEIAIFEPND------PAFYASFN 81

  Fly   189 TLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKGSD 253
            .||..|.:||.||::|||::||..|.:|.|:...||||:.|.|.||||.||||||:|||||..||
 Frog    82 ALKNYNSELKTLLSVGGWNYGTSGFNNMVSSPQNRQTFINSVITFLRKYGFDGLDIDWEYPGDSD 146

  Fly   254 ------DKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFINL 312
                  .|:.:.:||:|:..||..||.:...||||:||||..|...|..||.:|.::.|||.||:
 Frog   147 RGSPPETKEQYSILLQEMYNAFVQEASQSNLPRLLISAAVSAGMPTIEAGYQIPQLSQYLDLINV 211

  Fly   313 MAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLA 377
            |.||..|.||..||.::|||....|.......:||.|.:.|...||..|||::|.|.|||:|||:
 Frog   212 MTYDLRGSWEGFTGEDSPLYQGPADQGGYIYFNVDYAMNYWKNNGAAPEKLMVGFPAYGRTFTLS 276

  Fly   378 NPDKHGPNAPASGGGREGVYTKEGGFLAYYEICEMLLNGAVYVWDDEMKVPYLVDGDQWVGFDDE 442
            :|..:|..||.||||....||:|.||:||:|||..|..||..||:....|||...|.:|:|:|:|
 Frog   277 DPSNNGLGAPTSGGGPAAPYTQESGFMAYFEICNFLKQGATVVWNSPQAVPYAYKGSEWIGYDNE 341

  Fly   443 RAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCG-GNVKYPLIGAMREELLGIS 495
            ::.:.|..|:..|.|||||||.:.:|||.|..|| ||  |||:..:: ..||||
 Frog   342 KSFQIKAEWLMKNNFGGAMVWALPLDDFSGHFCGQGN--YPLMNTLK-STLGIS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 157/349 (45%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 167/372 (45%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
XB5763442XP_031751817.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 354 1.000 Domainoid score I993
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm9484
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.