DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Muc26B

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster


Alignment Length:42 Identity:14/42 - (33%)
Similarity:21/42 - (50%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   967 CTHYYMCEGERKHHMPCPANLVFNPQENVCDWPENVEGCHTP 1008
            |:.||:|...:...:.| .:..||..:.:||.|||.. |..|
  Fly   430 CSDYYICRYGKPLLVSC-GDKYFNALKGICDLPENTR-CVQP 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884 12/37 (32%)
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884
CBM_14 415..463 CDD:279884 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.