DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Muc26B

DIOPT Version :10

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster


Alignment Length:42 Identity:14/42 - (33%)
Similarity:21/42 - (50%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   967 CTHYYMCEGERKHHMPCPANLVFNPQENVCDWPENVEGCHTP 1008
            |:.||:|...:...:.| .:..||..:.:||.|||.. |..|
  Fly   430 CSDYYICRYGKPLLVSC-GDKYFNALKGICDLPENTR-CVQP 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 GH18_chitolectin_chitotriosidase 125..491 CDD:119351
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:426342 12/37 (32%)
Muc26BNP_652552.1 CBM_14 43..86 CDD:426342
CBM_14 415..463 CDD:426342 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.