DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Cht5

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster


Alignment Length:536 Identity:181/536 - (33%)
Similarity:267/536 - (49%) Gaps:84/536 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TKVDDGTPKIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNV 180
            |...|...:||||::||:.||..||::..||:|||||||||::|          ...||::.|.:
  Fly    20 TVASDQASRIVCYFSNWAVYRTGIGRYGLEDVPADLCTHIIYSF----------IGVNDKSWDVL 74

  Fly   181 ---------PGLYERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRK 236
                     .|.:.:...|||:||.:|:.:|:|||:.|..|:..|.:.|..||:|:.|.:.|:::
  Fly    75 VIDPELDVDQGGFSKFTQLKKSNPNVKLEIAVGGWAEGGSKYSQMVAVRDRRQSFIRSVVRFMKQ 139

  Fly   237 RGFDGLDMDWEYPKGSD------DKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIR 295
            ..|||.|:|||||..:|      ||..|:..::|||.||:.|.:..:     ::.||||....:.
  Fly   140 YNFDGFDLDWEYPGATDRGGNYGDKDKFLYFVEELRRAFDREGRGWE-----ITMAVPVAKFRLN 199

  Fly   296 GGYDVPAIASYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPK 360
            .||.||.:...||.|:.|.||..|.|......::|||....|....::|:|::..:||.:||.|.
  Fly   200 EGYHVPELCEALDAIHAMTYDLRGNWAGFADVHSPLYKRKHDQYAYEKLNVNDGLALWEEMGCPA 264

  Fly   361 EKLVIGMPTYGRSFTLANPDKH---GP--NAPASGGGREGVYTKEGGFLAYYEICEMLLN---GA 417
            .|||:|:|.|||:|||:|.:|:   |.  |..| |||..|.||...|||||||||..:::   |.
  Fly   265 NKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEA-GGGAPGPYTNASGFLAYYEICTEVMDKSKGW 328

  Fly   418 VYVWDDEMKVPYLVDGDQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCG--GNVK 480
            ...|||...|||.....||||:::|.:|:.||.:||..|:.|||.|.||||||.| :||  ..:.
  Fly   329 TVEWDDAGMVPYTYKDTQWVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDDFHG-MCGRKNGLT 392

  Fly   481 YPLIGAMREELLGISRGKEAKDVNWTAVAATFEDIEE--------------KPEPIKIS------ 525
            ..|...|:...:.....:......|....||..:.:|              ||:|...|      
  Fly   393 QILYDNMKNYRVPEPTRQTTPRPEWAKPPATPPNPDEGAVVAPTTSTTKRPKPKPKPTSSPLSPT 457

  Fly   526 -----VDEILNKVRKPQVQKKQRIKSGANAVASNTRPA--------QVFCY----LTSWSAKRPG 573
                 |..:.:...||..:|.::.|.  ....:.|.||        :...|    :.....::|.
  Fly   458 SAPGPVPTVGSSTPKPTTKKPKKPKK--TTTTTTTTPAPEKSTEEPEEVVYPVDPVEPTDPEQPM 520

  Fly   574 AGKFQPENIDPKLCTH 589
            ..:|.|..||   ||:
  Fly   521 GPQFDPNEID---CTN 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 146/366 (40%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 155/390 (40%)
Glyco_18 559..898 CDD:214753 8/35 (23%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 8/34 (24%)
CBM_14 951..1005 CDD:279884
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 146/366 (40%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 154/384 (40%)
Trypan_PARP 367..469 CDD:114603 25/102 (25%)
CBM_14 531..578 CDD:279884 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
87.920

Return to query results.
Submit another query.