DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and chia.1

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_998215.1 Gene:chia.1 / 406323 ZFINID:ZDB-GENE-040426-1994 Length:455 Species:Danio rerio


Alignment Length:457 Identity:172/457 - (37%)
Similarity:258/457 - (56%) Gaps:27/457 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 VASNTRPAQVFCYLTSWSAKRPGAGKFQPENIDPKLCTHIVYAFATLQ-DYKLTEATDDDPENYE 614
            :.|:|:   :.||:|:||..|||.|||.||||||.||||:|||.||:. |.::|....:|.:.|:
Zfish    18 IVSSTK---LVCYMTNWSQYRPGNGKFLPENIDPFLCTHVVYALATISYDNQITTIEWNDVDLYK 79

  Fly   615 SVIALRDNNPDLQILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYP- 678
            |:..|:..||.|:..|::||...|.:|:..:.:.......|:..|:.|||.::|:|:|:||:|| 
Zfish    80 SMNELKKVNPALKTQLSVGGLVNGVSPYINMVATPENRKAFIRNALLFLRLHEFDGMDIDWQYPG 144

  Fly   679 -RGA--EDRVAYVSLLKELRVAFEGEAKSSGLPRLLLTAAVPASFEAIAAGYDVPEISKYLDFIN 740
             .|:  :|:....:.:||:|.|.|.||..:....|||:..|.|....|...|:..|::..:||:.
Zfish   145 HNGSPPQDKQRLTTFIKEMRDAIEQEAIDTKKTPLLLSIKVSAIKTTIENAYEAKEVASLVDFVT 209

  Fly   741 VMTYDFHGQWERTVGHNSPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLIGMPTYGRSFEL 805
            :|:||:||.|:...|||||||.....||......::.|...|:..|||.::||:|:|||||:| :
Zfish   210 IMSYDYHGHWDPITGHNSPLFRSSFDTGSIVHHNINSSLEFWLGSGAPADRLLLGLPTYGRTF-M 273

  Fly   806 VNDTQFDIGSPSSGGGKAGKFTNEAGFLSYYEVCSFLAADNTTLVWDSEQQVPFAYRGNQWVGFD 870
            ::.:|..:|:|::|...||.:|.||||.||||:|..  ..:..:.|..||.||:|.:|..|||||
Zfish   274 LSTSQTGLGAPANGPADAGPYTREAGFWSYYEICPM--ESSVPIHWIDEQMVPYAVQGRAWVGFD 336

  Fly   871 DERSLKTKTEWLKEQGFGGIMVWSIDMDDFSGR-CGSGKYPLLTALNDELKDYKVELEYDG--PY 932
            ::.|:..|.:||.....||..||::|.|||:|| |.:|.|||:..|.:.|          |  |.
Zfish   337 NQESITAKVQWLNSLKLGGASVWTLDFDDFAGRFCYNGAYPLVNHLRNSL----------GFPPK 391

  Fly   933 ESHGPRGAYTTKDPHDVTCAEEDGHISYHKDWADCTHYYMCEGERKHHMPCPANLVFNPQENVCD 997
            .:..||.. ||.||.:..|..:...:..|.  .|.:.|:.|.....:...|...|||......||
Zfish   392 PTTTPRPT-TTADPINSFCVGKPDGLYPHP--TDASKYFHCFRGNTYLQQCQPGLVFVDACKCCD 453

  Fly   998 WP 999
            ||
Zfish   454 WP 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 137/343 (40%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 148/364 (41%)
CBM_14 951..1005 CDD:279884 13/49 (27%)
chia.1NP_998215.1 Glyco_18 23..364 CDD:214753 137/346 (40%)
GH18_chitolectin_chitotriosidase 24..386 CDD:119351 148/364 (41%)
ChtBD2 407..455 CDD:214696 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592098
Domainoid 1 1.000 352 1.000 Domainoid score I965
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm6443
orthoMCL 1 0.900 - - OOG6_100224
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.