DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Cht2

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster


Alignment Length:449 Identity:163/449 - (36%)
Similarity:227/449 - (50%) Gaps:82/449 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 AVASNTRPAQ---VFCYLTSWSAKRPGAGKFQPENIDPKLCTHIVYAFATLQDYKLTEAT--DDD 609
            :||:.|.|..   |.||:::|:..||..|.:..||.||.||||:|||||.|.   :|:|.  ..|
  Fly    30 SVAARTGPLHDKVVVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLD---ITQAAIKSLD 91

  Fly   610 P----------ENYESVIALRDNNPDLQILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLR 664
            |          ..||.:..|:.::|.|::.||||||..||..:..|.:|.....:||.:...|:|
  Fly    92 PWQDLKEEYGKGGYEKMTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIR 156

  Fly   665 DYKFNGLDVDWEYPRGAE----DRVAYVSLLKELRVAFEGEAKSSGLPRLLLTAAVPASFEAIAA 725
            .|.|:|||:|||||...:    ||..:|.|.||||..|:...       ||||:|:.||.:.|..
  Fly   157 KYNFDGLDLDWEYPTQRKGKPADRENFVLLTKELREEFDEHG-------LLLTSAIGASKKVIDE 214

  Fly   726 GYDVPEISKYLDFINVMTYDFHGQWERTVGHNSPLFALESATGYQKKLTVDYSAREWVKQGAPKE 790
            .|||.:||:|||::::|.||:||.|:|.||:|:||.| .:......|.::||    .:|.|||.|
  Fly   215 AYDVRQISRYLDYLHIMCYDYHGSWDRRVGYNAPLTA-PADDPLSVKFSIDY----LLKLGAPPE 274

  Fly   791 KLLIGMPTYGRSFE-----LVNDTQFDIGSPSSGGGKAGKFTNEAGFLSYYEVCSFLAADNT--T 848
            ||::|:|.|||:|:     .:||.       |.|.|..|.:|.|.|||.|.|:|..|:...:  |
  Fly   275 KLVMGLPFYGRTFKTLASGFLNDV-------SEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWT 332

  Fly   849 LVWD---------SEQQVPFAYRGNQWVGFDDERSLKTKTEWLKEQGFGGIMVWSIDMDDFSGRC 904
            ..||         ||:.| |....|. |.:|..||:..|..:...:...|:||||:|.|||.|.|
  Fly   333 REWDPQTSQVLAKSERNV-FTQEINV-VTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGNC 395

  Fly   905 -------------------GSGKYPLLTALNDELKDYKVELEYDGPY----ESHGPRGA 940
                               .|..||||..:|:.......||....|.    |:..|.|:
  Fly   396 KLDEDTYEDFQKVTAAPKRSSQNYPLLRTINEATMLAVDELAVPEPQPDDSENEIPHGS 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 142/373 (38%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 153/409 (37%)
CBM_14 951..1005 CDD:279884
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 142/370 (38%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 153/408 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
87.920

Return to query results.
Submit another query.